SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30137.Seq
         (875 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM050259-1|CAJ18340.1|  683|Apis mellifera putative H3K9 methylt...    26   0.40 
AF469010-1|AAL93136.1|  678|Apis mellifera cGMP-dependent protei...    24   2.1  
AB270697-1|BAF75928.1|  735|Apis mellifera FoxP protein protein.       23   2.8  
DQ435327-1|ABD92642.1|  145|Apis mellifera OBP10 protein.              22   6.5  
AY395073-1|AAQ96729.1|  203|Apis mellifera GABA neurotransmitter...    22   8.5  
AF084556-1|AAC71015.1|  652|Apis mellifera pipsqueak protein.          22   8.5  

>AM050259-1|CAJ18340.1|  683|Apis mellifera putative H3K9
           methyltransferase protein.
          Length = 683

 Score = 26.2 bits (55), Expect = 0.40
 Identities = 26/107 (24%), Positives = 49/107 (45%), Gaps = 6/107 (5%)
 Frame = +2

Query: 245 NLCYSKDD---TKDYDVAAKSQLKKIQKIWVRENYKAMDKAKAEEENTEKRS---QNLDE 406
           N  YSK +   + + DV  K   ++ Q I  R+N   +D  +   ENTE +S    ++++
Sbjct: 141 NYFYSKSNGSNSSNSDVLFKQNKEEEQTI-NRKNSDYLDNQEVSMENTENKSCTDSDIEK 199

Query: 407 AKKILLQEDPSLPKATVVKICETTEHRGQRICIRDGYIVSGAKVNLW 547
            K     E+  L +  +  I E  +H   R   ++G     ++ ++W
Sbjct: 200 YKMFCNLENVKLKELRI--ILEDIKHINTRHNTKNGMKTLLSETDIW 244


>AF469010-1|AAL93136.1|  678|Apis mellifera cGMP-dependent protein
           kinase foraging protein.
          Length = 678

 Score = 23.8 bits (49), Expect = 2.1
 Identities = 6/11 (54%), Positives = 10/11 (90%)
 Frame = +1

Query: 703 GHELTADYWGI 735
           GH+++ADYW +
Sbjct: 541 GHDISADYWSL 551


>AB270697-1|BAF75928.1|  735|Apis mellifera FoxP protein protein.
          Length = 735

 Score = 23.4 bits (48), Expect = 2.8
 Identities = 8/17 (47%), Positives = 11/17 (64%)
 Frame = +2

Query: 212 NASCWQRAISHNLCYSK 262
           NA+ W+ A+ HNL   K
Sbjct: 544 NAATWKNAVRHNLSLHK 560


>DQ435327-1|ABD92642.1|  145|Apis mellifera OBP10 protein.
          Length = 145

 Score = 22.2 bits (45), Expect = 6.5
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = -1

Query: 242 GKWLFASMMHCFQYCLEWFLF 180
           G+W     + C+ YCL W  F
Sbjct: 61  GQWPETRQLKCYMYCL-WEQF 80


>AY395073-1|AAQ96729.1|  203|Apis mellifera GABA neurotransmitter
           transporter-1A protein.
          Length = 203

 Score = 21.8 bits (44), Expect = 8.5
 Identities = 8/53 (15%), Positives = 18/53 (33%)
 Frame = +2

Query: 173 WYERETIQDNIESNASCWQRAISHNLCYSKDDTKDYDVAAKSQLKKIQKIWVR 331
           W  +  +      + SCW +   H+         D ++        +++ W R
Sbjct: 105 WNTKNCVNPYDRDSLSCWLQMTKHHNFIKVCSVNDVNMTITELTDPVKEFWER 157


>AF084556-1|AAC71015.1|  652|Apis mellifera pipsqueak protein.
          Length = 652

 Score = 21.8 bits (44), Expect = 8.5
 Identities = 9/18 (50%), Positives = 12/18 (66%)
 Frame = +2

Query: 719 LITGELIGLAPPGGATPS 772
           +IT EL+GL P G +  S
Sbjct: 370 MITPELLGLMPSGSSVHS 387


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 238,490
Number of Sequences: 438
Number of extensions: 5613
Number of successful extensions: 20
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 19
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 20
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 28402218
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -