SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30123.Seq
         (694 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ780964-1|CAG62942.2|  332|Apis mellifera putative corticotropi...    23   2.8  
DQ151547-1|ABA39280.1|  405|Apis mellifera tyramine receptor pro...    22   6.4  
AB253416-1|BAE86927.1|  580|Apis mellifera alpha-glucosidase pro...    22   6.4  

>AJ780964-1|CAG62942.2|  332|Apis mellifera putative corticotropin
           releasing hormone-binding protein protein.
          Length = 332

 Score = 23.0 bits (47), Expect = 2.8
 Identities = 15/57 (26%), Positives = 27/57 (47%), Gaps = 1/57 (1%)
 Frame = +2

Query: 266 DQRVLQRGIGWEI-CSSHGSYRLEAGHDGRGEVGTLRMPIQTGQFRLRTKLCGQQLG 433
           DQ++    I ++I C   G   +  G +  GEV   +M  Q    +  ++ CG+ +G
Sbjct: 101 DQKIEINFITFDIPCEHRGLVSIIDGWELNGEVFPSKMDHQLPLKQRSSEFCGKNIG 157


>DQ151547-1|ABA39280.1|  405|Apis mellifera tyramine receptor
           protein.
          Length = 405

 Score = 21.8 bits (44), Expect = 6.4
 Identities = 8/30 (26%), Positives = 19/30 (63%)
 Frame = -1

Query: 604 ILFAYPVHEVAYLIRNRYRHLASVTSENLQ 515
           ++  Y    ++ +I +R+R+L +  SEN++
Sbjct: 212 LVMLYVYGRISCVIASRHRNLEATESENVR 241


>AB253416-1|BAE86927.1|  580|Apis mellifera alpha-glucosidase
           protein.
          Length = 580

 Score = 21.8 bits (44), Expect = 6.4
 Identities = 12/35 (34%), Positives = 19/35 (54%)
 Frame = -2

Query: 222 IDAVLVRYHLPELSADLVSTRTDLEIDNFPHLVNL 118
           IDA+   +    L  +  + RTDL  D++  LV+L
Sbjct: 222 IDAINHMFEDARLLDEPSANRTDLSKDDYESLVHL 256


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 191,774
Number of Sequences: 438
Number of extensions: 3912
Number of successful extensions: 5
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 21195810
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -