SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30122.Seq
         (669 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF274024-1|AAF90150.1|  232|Apis mellifera tetraspanin F139 prot...    25   0.86 
DQ325113-1|ABD14127.1|  185|Apis mellifera complementary sex det...    23   3.5  
DQ325112-1|ABD14126.1|  185|Apis mellifera complementary sex det...    23   3.5  
DQ325111-1|ABD14125.1|  185|Apis mellifera complementary sex det...    23   3.5  
DQ325110-1|ABD14124.1|  185|Apis mellifera complementary sex det...    23   3.5  
AY736135-1|AAU84701.1|  253|Apis mellifera take-out-like carrier...    22   4.6  
AY395073-1|AAQ96729.1|  203|Apis mellifera GABA neurotransmitter...    22   4.6  
AF388659-1|AAK71995.1|  782|Apis mellifera 1D-myo-inositol-trisp...    22   4.6  
AF004842-1|AAD01205.1|  598|Apis mellifera major royal jelly pro...    22   4.6  
AY336529-1|AAQ02340.1|  712|Apis mellifera transferrin protein.        22   6.1  
AY336528-1|AAQ02339.1|  712|Apis mellifera transferrin protein.        22   6.1  
AY217097-1|AAO39761.1|  712|Apis mellifera transferrin protein.        22   6.1  
DQ667184-1|ABG75736.1|  489|Apis mellifera GABA-gated ion channe...    21   8.0  
AY569717-1|AAS86670.1|  397|Apis mellifera complementary sex det...    21   8.0  
AY569712-1|AAS86665.1|  408|Apis mellifera complementary sex det...    21   8.0  
AY569703-1|AAS86656.1|  396|Apis mellifera complementary sex det...    21   8.0  
AY569701-1|AAS86654.1|  407|Apis mellifera complementary sex det...    21   8.0  
AY569700-1|AAS86653.1|  407|Apis mellifera complementary sex det...    21   8.0  
AY569699-1|AAS86652.1|  396|Apis mellifera complementary sex det...    21   8.0  
AY569698-1|AAS86651.1|  407|Apis mellifera complementary sex det...    21   8.0  
AY569696-1|AAS86649.1|  414|Apis mellifera complementary sex det...    21   8.0  
AY569695-1|AAS86648.1|  414|Apis mellifera complementary sex det...    21   8.0  
AY569694-1|AAS86647.1|  400|Apis mellifera complementary sex det...    21   8.0  
AF000632-1|AAC61894.1|  452|Apis mellifera major royal jelly pro...    21   8.0  

>AF274024-1|AAF90150.1|  232|Apis mellifera tetraspanin F139
           protein.
          Length = 232

 Score = 24.6 bits (51), Expect = 0.86
 Identities = 12/25 (48%), Positives = 18/25 (72%), Gaps = 1/25 (4%)
 Frame = -3

Query: 589 VYGSL-FSTMLLEVIGIRCPLSLAN 518
           V+GS+  +  ++E+IGI C L LAN
Sbjct: 196 VFGSVAIAIAIVELIGIICALCLAN 220


>DQ325113-1|ABD14127.1|  185|Apis mellifera complementary sex
           determiner protein.
          Length = 185

 Score = 22.6 bits (46), Expect = 3.5
 Identities = 11/27 (40%), Positives = 15/27 (55%)
 Frame = +3

Query: 165 RSSAIKKKREIFKRAEQYVKEYRIKER 245
           RS +  + RE  K+  QY K Y  KE+
Sbjct: 2   RSCSRDRNREYRKKDRQYEKLYNEKEK 28


>DQ325112-1|ABD14126.1|  185|Apis mellifera complementary sex
           determiner protein.
          Length = 185

 Score = 22.6 bits (46), Expect = 3.5
 Identities = 11/27 (40%), Positives = 15/27 (55%)
 Frame = +3

Query: 165 RSSAIKKKREIFKRAEQYVKEYRIKER 245
           RS +  + RE  K+  QY K Y  KE+
Sbjct: 2   RSCSRDRNREYRKKDRQYEKLYNEKEK 28


>DQ325111-1|ABD14125.1|  185|Apis mellifera complementary sex
           determiner protein.
          Length = 185

 Score = 22.6 bits (46), Expect = 3.5
 Identities = 11/27 (40%), Positives = 15/27 (55%)
 Frame = +3

Query: 165 RSSAIKKKREIFKRAEQYVKEYRIKER 245
           RS +  + RE  K+  QY K Y  KE+
Sbjct: 2   RSCSRDRNREYRKKDRQYEKLYNEKEK 28


>DQ325110-1|ABD14124.1|  185|Apis mellifera complementary sex
           determiner protein.
          Length = 185

 Score = 22.6 bits (46), Expect = 3.5
 Identities = 11/27 (40%), Positives = 15/27 (55%)
 Frame = +3

Query: 165 RSSAIKKKREIFKRAEQYVKEYRIKER 245
           RS +  + RE  K+  QY K Y  KE+
Sbjct: 2   RSCSRDRNREYRKKDRQYEKLYNEKEK 28


>AY736135-1|AAU84701.1|  253|Apis mellifera take-out-like carrier
           protein JHBP-1 protein.
          Length = 253

 Score = 22.2 bits (45), Expect = 4.6
 Identities = 9/22 (40%), Positives = 15/22 (68%)
 Frame = +1

Query: 136 LGDYRLR*RGVLLPSRRRGKSS 201
           + DY++  + +LLP R  GKS+
Sbjct: 128 VADYKIEGKVLLLPVRGAGKSN 149


>AY395073-1|AAQ96729.1|  203|Apis mellifera GABA neurotransmitter
           transporter-1A protein.
          Length = 203

 Score = 22.2 bits (45), Expect = 4.6
 Identities = 8/21 (38%), Positives = 12/21 (57%)
 Frame = -1

Query: 579 ASSQQCCWK*LVYVVHSAWRI 517
           A++   CW  + Y+V  AW I
Sbjct: 65  AAAVMSCWMNVYYIVILAWAI 85


>AF388659-1|AAK71995.1|  782|Apis mellifera
           1D-myo-inositol-trisphosphate 3-kinaseisoform A protein.
          Length = 782

 Score = 22.2 bits (45), Expect = 4.6
 Identities = 8/21 (38%), Positives = 12/21 (57%)
 Frame = +2

Query: 326 RIRGINQVSPKSVKFCNCLDC 388
           +  GI+  +P     C+CLDC
Sbjct: 312 KYEGISS-TPSQASSCSCLDC 331


>AF004842-1|AAD01205.1|  598|Apis mellifera major royal jelly
           protein MRJP5 protein.
          Length = 598

 Score = 22.2 bits (45), Expect = 4.6
 Identities = 8/22 (36%), Positives = 12/22 (54%)
 Frame = +1

Query: 445 RIAEPYIAWGYPNLKSVRELVS 510
           R+ +PY  W + N K    +VS
Sbjct: 106 RLLQPYPDWSWANYKDCSGIVS 127


>AY336529-1|AAQ02340.1|  712|Apis mellifera transferrin protein.
          Length = 712

 Score = 21.8 bits (44), Expect = 6.1
 Identities = 9/16 (56%), Positives = 11/16 (68%)
 Frame = -3

Query: 541 RCPLSLANPRLILTHG 494
           RC L L  PR+IL+ G
Sbjct: 625 RCNLGLEPPRVILSSG 640


>AY336528-1|AAQ02339.1|  712|Apis mellifera transferrin protein.
          Length = 712

 Score = 21.8 bits (44), Expect = 6.1
 Identities = 9/16 (56%), Positives = 11/16 (68%)
 Frame = -3

Query: 541 RCPLSLANPRLILTHG 494
           RC L L  PR+IL+ G
Sbjct: 625 RCNLGLEPPRVILSSG 640


>AY217097-1|AAO39761.1|  712|Apis mellifera transferrin protein.
          Length = 712

 Score = 21.8 bits (44), Expect = 6.1
 Identities = 9/16 (56%), Positives = 11/16 (68%)
 Frame = -3

Query: 541 RCPLSLANPRLILTHG 494
           RC L L  PR+IL+ G
Sbjct: 625 RCNLGLEPPRVILSSG 640


>DQ667184-1|ABG75736.1|  489|Apis mellifera GABA-gated ion channel
           protein.
          Length = 489

 Score = 21.4 bits (43), Expect = 8.0
 Identities = 12/47 (25%), Positives = 19/47 (40%)
 Frame = +1

Query: 322 HPNPWYQPSFTEVRKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPY 462
           H   W Q  F  ++ +  +      N G+  RL   T  + RI + Y
Sbjct: 2   HHRMWLQQIFILLQMIHLIAWASLENTGISDRLENVTQTISRILDGY 48


>AY569717-1|AAS86670.1|  397|Apis mellifera complementary sex
           determiner protein.
          Length = 397

 Score = 21.4 bits (43), Expect = 8.0
 Identities = 10/29 (34%), Positives = 16/29 (55%)
 Frame = +3

Query: 159 KRRSSAIKKKREIFKRAEQYVKEYRIKER 245
           + RS +  + RE  K+  QY K +  KE+
Sbjct: 222 RERSCSRDRNREYRKKDRQYEKLHNEKEK 250


>AY569712-1|AAS86665.1|  408|Apis mellifera complementary sex
           determiner protein.
          Length = 408

 Score = 21.4 bits (43), Expect = 8.0
 Identities = 10/29 (34%), Positives = 16/29 (55%)
 Frame = +3

Query: 159 KRRSSAIKKKREIFKRAEQYVKEYRIKER 245
           + RS +  + RE  K+  QY K +  KE+
Sbjct: 233 RERSCSRDRNREYRKKDRQYEKLHNEKEK 261


>AY569703-1|AAS86656.1|  396|Apis mellifera complementary sex
           determiner protein.
          Length = 396

 Score = 21.4 bits (43), Expect = 8.0
 Identities = 10/29 (34%), Positives = 16/29 (55%)
 Frame = +3

Query: 159 KRRSSAIKKKREIFKRAEQYVKEYRIKER 245
           + RS +  + RE  K+  QY K +  KE+
Sbjct: 222 RERSCSRDRNREYRKKDRQYEKLHNEKEK 250


>AY569701-1|AAS86654.1|  407|Apis mellifera complementary sex
           determiner protein.
          Length = 407

 Score = 21.4 bits (43), Expect = 8.0
 Identities = 10/29 (34%), Positives = 16/29 (55%)
 Frame = +3

Query: 159 KRRSSAIKKKREIFKRAEQYVKEYRIKER 245
           + RS +  + RE  K+  QY K +  KE+
Sbjct: 233 RERSCSRDRNREYRKKDRQYEKLHNEKEK 261


>AY569700-1|AAS86653.1|  407|Apis mellifera complementary sex
           determiner protein.
          Length = 407

 Score = 21.4 bits (43), Expect = 8.0
 Identities = 10/29 (34%), Positives = 16/29 (55%)
 Frame = +3

Query: 159 KRRSSAIKKKREIFKRAEQYVKEYRIKER 245
           + RS +  + RE  K+  QY K +  KE+
Sbjct: 233 RERSCSRDRNREYRKKDRQYEKLHNEKEK 261


>AY569699-1|AAS86652.1|  396|Apis mellifera complementary sex
           determiner protein.
          Length = 396

 Score = 21.4 bits (43), Expect = 8.0
 Identities = 10/29 (34%), Positives = 16/29 (55%)
 Frame = +3

Query: 159 KRRSSAIKKKREIFKRAEQYVKEYRIKER 245
           + RS +  + RE  K+  QY K +  KE+
Sbjct: 222 RERSCSRDRNREYRKKDRQYEKLHNEKEK 250


>AY569698-1|AAS86651.1|  407|Apis mellifera complementary sex
           determiner protein.
          Length = 407

 Score = 21.4 bits (43), Expect = 8.0
 Identities = 10/29 (34%), Positives = 16/29 (55%)
 Frame = +3

Query: 159 KRRSSAIKKKREIFKRAEQYVKEYRIKER 245
           + RS +  + RE  K+  QY K +  KE+
Sbjct: 233 RERSCSRDRNREYRKKDRQYEKLHNEKEK 261


>AY569696-1|AAS86649.1|  414|Apis mellifera complementary sex
           determiner protein.
          Length = 414

 Score = 21.4 bits (43), Expect = 8.0
 Identities = 10/29 (34%), Positives = 16/29 (55%)
 Frame = +3

Query: 159 KRRSSAIKKKREIFKRAEQYVKEYRIKER 245
           + RS +  + RE  K+  QY K +  KE+
Sbjct: 233 RERSCSRDRNREYRKKDRQYEKLHNEKEK 261


>AY569695-1|AAS86648.1|  414|Apis mellifera complementary sex
           determiner protein.
          Length = 414

 Score = 21.4 bits (43), Expect = 8.0
 Identities = 10/29 (34%), Positives = 16/29 (55%)
 Frame = +3

Query: 159 KRRSSAIKKKREIFKRAEQYVKEYRIKER 245
           + RS +  + RE  K+  QY K +  KE+
Sbjct: 233 RERSCSRDRNREYRKKDRQYEKLHNEKEK 261


>AY569694-1|AAS86647.1|  400|Apis mellifera complementary sex
           determiner protein.
          Length = 400

 Score = 21.4 bits (43), Expect = 8.0
 Identities = 10/29 (34%), Positives = 16/29 (55%)
 Frame = +3

Query: 159 KRRSSAIKKKREIFKRAEQYVKEYRIKER 245
           + RS +  + RE  K+  QY K +  KE+
Sbjct: 222 RERSCSRDRNREYRKKDRQYEKLHNEKEK 250


>AF000632-1|AAC61894.1|  452|Apis mellifera major royal jelly
           protein MRJP2 protein.
          Length = 452

 Score = 21.4 bits (43), Expect = 8.0
 Identities = 7/22 (31%), Positives = 12/22 (54%)
 Frame = +1

Query: 445 RIAEPYIAWGYPNLKSVRELVS 510
           R+ +PY  W +   K   ++VS
Sbjct: 103 RLLKPYPDWSFAEFKDCSKIVS 124


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 169,271
Number of Sequences: 438
Number of extensions: 3651
Number of successful extensions: 36
Number of sequences better than 10.0: 24
Number of HSP's better than 10.0 without gapping: 36
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 36
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 20221290
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -