SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30117.Seq
         (608 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF531707-1|ABP57431.1|  138|Apis mellifera structural cuticle pr...    25   0.44 
AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.              25   0.58 
AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr...    23   2.3  
DQ869053-1|ABJ09600.1|  459|Apis mellifera capa-like receptor pr...    21   7.1  
AB022908-1|BAA86909.1|  493|Apis mellifera amylase protein.            21   9.4  

>EF531707-1|ABP57431.1|  138|Apis mellifera structural cuticle
           protein protein.
          Length = 138

 Score = 25.4 bits (53), Expect = 0.44
 Identities = 11/29 (37%), Positives = 14/29 (48%)
 Frame = +3

Query: 324 DGEAVEFAVVAGEKGFEAAGVTGPGGEPV 410
           DG+ V    VA E GF+  G   P   P+
Sbjct: 81  DGQQVSITYVADENGFQVQGSHIPTAPPI 109


>AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.
          Length = 1946

 Score = 25.0 bits (52), Expect = 0.58
 Identities = 13/37 (35%), Positives = 20/37 (54%), Gaps = 1/37 (2%)
 Frame = +1

Query: 241  RNDTKKMCLCIRLPSP-VTTHVRLCARSATERRWSLP 348
            + D K  CL + +P+P VT  VR     +++R   LP
Sbjct: 1291 KEDVKLPCLAVGVPAPEVTWKVRGAVLQSSDRLRQLP 1327


>AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein
           protein.
          Length = 1308

 Score = 23.0 bits (47), Expect = 2.3
 Identities = 11/43 (25%), Positives = 20/43 (46%)
 Frame = +3

Query: 210 QRQEWIWFHQQE*HQEDVFVHQTAIARNNPRKAVRSVGDGEAV 338
           +R+EW++ H+     E    HQ        +K V S+   +A+
Sbjct: 726 RRKEWLYLHRARSESEFEMYHQQLQGVAKNKKNVGSMSRNKAL 768


>DQ869053-1|ABJ09600.1|  459|Apis mellifera capa-like receptor
           protein.
          Length = 459

 Score = 21.4 bits (43), Expect = 7.1
 Identities = 9/19 (47%), Positives = 12/19 (63%)
 Frame = -1

Query: 485 SSATLTREILAVVATALVC 429
           S  T+TR + AVV T  +C
Sbjct: 254 SRKTITRMLSAVVITFFIC 272


>AB022908-1|BAA86909.1|  493|Apis mellifera amylase protein.
          Length = 493

 Score = 21.0 bits (42), Expect = 9.4
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = -3

Query: 72  VIGERRWWQRW 40
           VI +R WW+R+
Sbjct: 70  VIDKRPWWERY 80


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 134,752
Number of Sequences: 438
Number of extensions: 1969
Number of successful extensions: 5
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 17971191
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -