SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30114.Seq
         (672 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ257416-1|ABB81847.1|  552|Apis mellifera yellow-h protein.           24   1.5  
AY769960-1|AAV34676.1|  603|Apis mellifera soluble guanylyl cycl...    23   2.0  
AB181489-1|BAD22772.1|  603|Apis mellifera soluble guanylyl cycl...    23   2.0  
DQ855483-1|ABH88170.1|  117|Apis mellifera chemosensory protein ...    22   4.6  
DQ435327-1|ABD92642.1|  145|Apis mellifera OBP10 protein.              22   4.6  
AJ973398-1|CAJ01445.1|  117|Apis mellifera hypothetical protein ...    22   4.6  
AY338499-1|AAR08420.1|  500|Apis mellifera Kruppel-like protein ...    21   8.1  

>DQ257416-1|ABB81847.1|  552|Apis mellifera yellow-h protein.
          Length = 552

 Score = 23.8 bits (49), Expect = 1.5
 Identities = 14/51 (27%), Positives = 23/51 (45%)
 Frame = -1

Query: 423 SRGASLLLQPTDDVISLTTT*IVDRTXIPEEFESRVSSYTVALGEILFLSC 271
           ++G  L   P   +  LTT  ++ +  IP+E     S YT  + +I    C
Sbjct: 270 AKGGKLACPPAIFIFDLTTDTLIRKYIIPKEQVKEDSLYTNIVVDIRNEDC 320


>AY769960-1|AAV34676.1|  603|Apis mellifera soluble guanylyl cyclase
           beta 1 subunit protein.
          Length = 603

 Score = 23.4 bits (48), Expect = 2.0
 Identities = 10/28 (35%), Positives = 16/28 (57%)
 Frame = -2

Query: 203 VPEICSGRTMEHRIQLKCTPWL*LQFQS 120
           +P++CSG    + I L   P L L F++
Sbjct: 238 IPQVCSGNCKLNDILLTVRPHLELTFEN 265


>AB181489-1|BAD22772.1|  603|Apis mellifera soluble guanylyl cyclase
           beta 1 subunit protein.
          Length = 603

 Score = 23.4 bits (48), Expect = 2.0
 Identities = 10/28 (35%), Positives = 16/28 (57%)
 Frame = -2

Query: 203 VPEICSGRTMEHRIQLKCTPWL*LQFQS 120
           +P++CSG    + I L   P L L F++
Sbjct: 238 IPQVCSGNCKLNDILLTVRPHLELTFEN 265


>DQ855483-1|ABH88170.1|  117|Apis mellifera chemosensory protein 2
           protein.
          Length = 117

 Score = 22.2 bits (45), Expect = 4.6
 Identities = 10/26 (38%), Positives = 14/26 (53%)
 Frame = -3

Query: 277 ELRQLSLVDRRFFFSQLCCCLGVFRC 200
           E   ++L D+R+   QL C LG   C
Sbjct: 36  EQLNMALSDQRYLRRQLKCALGEAPC 61


>DQ435327-1|ABD92642.1|  145|Apis mellifera OBP10 protein.
          Length = 145

 Score = 22.2 bits (45), Expect = 4.6
 Identities = 8/16 (50%), Positives = 10/16 (62%)
 Frame = +3

Query: 453 RTYRCQYCYCIWFLFG 500
           R  +C Y YC+W  FG
Sbjct: 67  RQLKC-YMYCLWEQFG 81


>AJ973398-1|CAJ01445.1|  117|Apis mellifera hypothetical protein
           protein.
          Length = 117

 Score = 22.2 bits (45), Expect = 4.6
 Identities = 10/26 (38%), Positives = 14/26 (53%)
 Frame = -3

Query: 277 ELRQLSLVDRRFFFSQLCCCLGVFRC 200
           E   ++L D+R+   QL C LG   C
Sbjct: 36  EQLNMALSDQRYLRRQLKCALGEAPC 61


>AY338499-1|AAR08420.1|  500|Apis mellifera Kruppel-like protein 1
           protein.
          Length = 500

 Score = 21.4 bits (43), Expect = 8.1
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = +3

Query: 444 TG*RTYRCQYC 476
           TG + Y+C+YC
Sbjct: 115 TGEKPYQCEYC 125


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 168,356
Number of Sequences: 438
Number of extensions: 2960
Number of successful extensions: 8
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 20343105
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -