SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30102.Seq
         (594 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ244074-1|ABB36784.1|  517|Apis mellifera cytochrome P450 monoo...    24   1.3  
AF274024-1|AAF90150.1|  232|Apis mellifera tetraspanin F139 prot...    23   3.0  
AY921579-1|AAX14899.1|  996|Apis mellifera ephrin receptor protein.    22   3.9  
AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase...    22   3.9  
DQ026038-1|AAY87897.1|  520|Apis mellifera nicotinic acetylcholi...    21   9.1  

>DQ244074-1|ABB36784.1|  517|Apis mellifera cytochrome P450
           monooxygenase protein.
          Length = 517

 Score = 23.8 bits (49), Expect = 1.3
 Identities = 11/40 (27%), Positives = 21/40 (52%)
 Frame = +1

Query: 412 QHYV*ILRRHSIRSYAPWLRFSSRFVANRIXRGARYPIRP 531
           Q Y  + +  ++ ++     FS + +   I R +RYP+RP
Sbjct: 88  QRYGALCKEEALWNFPMISVFSRQDIETIIRRNSRYPLRP 127


>AF274024-1|AAF90150.1|  232|Apis mellifera tetraspanin F139
           protein.
          Length = 232

 Score = 22.6 bits (46), Expect = 3.0
 Identities = 13/35 (37%), Positives = 19/35 (54%)
 Frame = -3

Query: 499 FGSLRSAS*ILAMVRMNVLSDALKSIHNAEKRGKR 395
           FGS+  A  I+ ++ +        SI NAE+RG R
Sbjct: 197 FGSVAIAIAIVELIGIICALCLANSIKNAERRGYR 231


>AY921579-1|AAX14899.1|  996|Apis mellifera ephrin receptor protein.
          Length = 996

 Score = 22.2 bits (45), Expect = 3.9
 Identities = 9/25 (36%), Positives = 14/25 (56%)
 Frame = -1

Query: 582 SHDVVKRRPVNCNTTHYRXNWVPGP 508
           S +  K++P +C+T  YR   V  P
Sbjct: 560 SDECNKKQPSDCDTLEYRNGEVTTP 584


>AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase
           protein.
          Length = 1143

 Score = 22.2 bits (45), Expect = 3.9
 Identities = 6/20 (30%), Positives = 14/20 (70%)
 Frame = +2

Query: 287 ASSVIINDFKLSDVTVXHHH 346
           A+  +++ F++ +VT+  HH
Sbjct: 344 ANVAVLHSFQMKNVTIVDHH 363


>DQ026038-1|AAY87897.1|  520|Apis mellifera nicotinic acetylcholine
           receptor beta1subunit protein.
          Length = 520

 Score = 21.0 bits (42), Expect = 9.1
 Identities = 9/26 (34%), Positives = 13/26 (50%)
 Frame = +1

Query: 397 FSLAFQHYV*ILRRHSIRSYAPWLRF 474
           F LAF   + +  ++ I     WLRF
Sbjct: 56  FGLAFVQLINVNEKNQIMKSNVWLRF 81


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 131,419
Number of Sequences: 438
Number of extensions: 2202
Number of successful extensions: 6
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 17359926
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -