SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30099.Seq
         (730 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF013389-1|ABK54743.1|  172|Apis mellifera elongation factor 1-a...   236   2e-64
AY208278-1|AAO48970.1|  274|Apis mellifera elongation factor 1-a...   236   2e-64
AF015267-1|AAC38959.1|  461|Apis mellifera elongation factor-1al...   236   2e-64
X52884-1|CAA37066.1|  461|Apis mellifera elongation factor 1 alp...   227   8e-62
AF069739-1|AAC63272.2|  690|Apis mellifera translation initiatio...    36   4e-04
AM050259-1|CAJ18340.1|  683|Apis mellifera putative H3K9 methylt...    24   1.3  
DQ667186-1|ABG75738.1|  447|Apis mellifera glutamate-gated chlor...    24   1.7  
DQ667185-1|ABG75737.1|  447|Apis mellifera glutamate-gated chlor...    24   1.7  
AB253417-1|BAE86928.1|  567|Apis mellifera alpha-glucosidase pro...    23   2.9  
D79208-1|BAA11466.1|  567|Apis mellifera alpha-glucosidase protein.    23   3.9  
AY569781-1|AAS75781.1|  461|Apis mellifera neuronal nicotinic ac...    22   5.2  
AB204559-1|BAD89804.1|  832|Apis mellifera soluble guanylyl cycl...    22   6.8  

>EF013389-1|ABK54743.1|  172|Apis mellifera elongation factor
           1-alpha protein.
          Length = 172

 Score =  236 bits (577), Expect = 2e-64
 Identities = 114/141 (80%), Positives = 120/141 (85%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL
Sbjct: 6   KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 65

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LAFTLGVKQLIVGVNKMDSTEPPY      + +++     KKIGYNPAAVAFVPISGWHG
Sbjct: 66  LAFTLGVKQLIVGVNKMDSTEPPYSETRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 125

Query: 617 DNMLELQPKCLGSRDGQVERK 679
           DNMLE+  K    +   VERK
Sbjct: 126 DNMLEVSSKMPWFKGWTVERK 146



 Score = 30.3 bits (65), Expect = 0.019
 Identities = 14/22 (63%), Positives = 18/22 (81%), Gaps = 2/22 (9%)
 Frame = +3

Query: 669 WSV--R*GQADGKCLIEALDAI 728
           W+V  + G+ +GKCLIEALDAI
Sbjct: 141 WTVERKEGKVEGKCLIEALDAI 162


>AY208278-1|AAO48970.1|  274|Apis mellifera elongation factor
           1-alpha protein.
          Length = 274

 Score =  236 bits (577), Expect = 2e-64
 Identities = 114/141 (80%), Positives = 120/141 (85%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL
Sbjct: 22  KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 81

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LAFTLGVKQLIVGVNKMDSTEPPY      + +++     KKIGYNPAAVAFVPISGWHG
Sbjct: 82  LAFTLGVKQLIVGVNKMDSTEPPYSETRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 141

Query: 617 DNMLELQPKCLGSRDGQVERK 679
           DNMLE+  K    +   VERK
Sbjct: 142 DNMLEVSSKMPWFKGWTVERK 162



 Score = 30.3 bits (65), Expect = 0.019
 Identities = 14/22 (63%), Positives = 18/22 (81%), Gaps = 2/22 (9%)
 Frame = +3

Query: 669 WSV--R*GQADGKCLIEALDAI 728
           W+V  + G+ +GKCLIEALDAI
Sbjct: 157 WTVERKEGKVEGKCLIEALDAI 178



 Score = 27.5 bits (58), Expect = 0.14
 Identities = 11/11 (100%), Positives = 11/11 (100%)
 Frame = +1

Query: 196 WVLDKLKAERE 228
           WVLDKLKAERE
Sbjct: 1   WVLDKLKAERE 11


>AF015267-1|AAC38959.1|  461|Apis mellifera elongation factor-1alpha
           F2 protein.
          Length = 461

 Score =  236 bits (577), Expect = 2e-64
 Identities = 114/141 (80%), Positives = 120/141 (85%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL
Sbjct: 79  KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 138

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LAFTLGVKQLIVGVNKMDSTEPPY      + +++     KKIGYNPAAVAFVPISGWHG
Sbjct: 139 LAFTLGVKQLIVGVNKMDSTEPPYSETRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 198

Query: 617 DNMLELQPKCLGSRDGQVERK 679
           DNMLE+  K    +   VERK
Sbjct: 199 DNMLEVSSKMPWFKGWTVERK 219



 Score =  145 bits (352), Expect = 3e-37
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL
Sbjct: 1   MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 61  DKLKAERE 68



 Score = 30.3 bits (65), Expect = 0.019
 Identities = 14/22 (63%), Positives = 18/22 (81%), Gaps = 2/22 (9%)
 Frame = +3

Query: 669 WSV--R*GQADGKCLIEALDAI 728
           W+V  + G+ +GKCLIEALDAI
Sbjct: 214 WTVERKEGKVEGKCLIEALDAI 235


>X52884-1|CAA37066.1|  461|Apis mellifera elongation factor 1 alpha
           protein.
          Length = 461

 Score =  227 bits (555), Expect = 8e-62
 Identities = 109/141 (77%), Positives = 118/141 (83%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFET+KYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHAL
Sbjct: 79  KFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGIGEFEAGISKNGQTREHAL 138

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LAFTLGVKQLIVGVNKMD T+PPY      + +++     KKIGYN A+VAFVPISGWHG
Sbjct: 139 LAFTLGVKQLIVGVNKMDMTDPPYSEARFEEIKKEVSSYIKKIGYNTASVAFVPISGWHG 198

Query: 617 DNMLELQPKCLGSRDGQVERK 679
           DNMLE  PK    +  +VERK
Sbjct: 199 DNMLEPSPKTPWYKGWKVERK 219



 Score =  145 bits (352), Expect = 3e-37
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL
Sbjct: 1   MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 61  DKLKAERE 68



 Score = 28.7 bits (61), Expect = 0.059
 Identities = 13/15 (86%), Positives = 13/15 (86%)
 Frame = +3

Query: 684 GQADGKCLIEALDAI 728
           G ADGK LIEALDAI
Sbjct: 221 GNADGKTLIEALDAI 235


>AF069739-1|AAC63272.2|  690|Apis mellifera translation initiation
           factor 2 protein.
          Length = 690

 Score = 35.9 bits (79), Expect = 4e-04
 Identities = 35/118 (29%), Positives = 51/118 (43%)
 Frame = +2

Query: 281 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 460
           VT +D PGH  FI     G    D  VL+VAA  G  E       QT +   +A    V 
Sbjct: 195 VTFLDTPGHAAFISMRHRGAHITDIVVLVVAADDGVKE-------QTLQSIEMAKDAKV- 246

Query: 461 QLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHGDNMLEL 634
            +IV +NK+D      +   ++    K+    +++G     +  V IS   G N+ EL
Sbjct: 247 PIIVAINKIDKPNIDIIK--VQYELAKHGIVIEELG---GEIQCVKISALKGINLREL 299



 Score = 25.4 bits (53), Expect = 0.55
 Identities = 9/18 (50%), Positives = 13/18 (72%)
 Frame = +1

Query: 37  KTHINIVVIGHVDSGKST 90
           K H  + ++GHVD GK+T
Sbjct: 143 KRHPIVTIMGHVDHGKTT 160


>AM050259-1|CAJ18340.1|  683|Apis mellifera putative H3K9
          methyltransferase protein.
          Length = 683

 Score = 24.2 bits (50), Expect = 1.3
 Identities = 11/15 (73%), Positives = 11/15 (73%)
 Frame = +1

Query: 46 INIVVIGHVDSGKST 90
          INI  IGHV  GKST
Sbjct: 43 INIGTIGHVAHGKST 57


>DQ667186-1|ABG75738.1|  447|Apis mellifera glutamate-gated chloride
           channel protein.
          Length = 447

 Score = 23.8 bits (49), Expect = 1.7
 Identities = 12/54 (22%), Positives = 25/54 (46%)
 Frame = +2

Query: 215 RLSVXRYHNRYCSRKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAA 376
           R ++ ++   YC+ K  T +Y    +D    R+F   +I       C +L++ +
Sbjct: 208 RFTLEKFFTDYCNSKTNTGEYSCLKVDLLFKREFSYYLI--QIYIPCCMLVIVS 259


>DQ667185-1|ABG75737.1|  447|Apis mellifera glutamate-gated chloride
           channel protein.
          Length = 447

 Score = 23.8 bits (49), Expect = 1.7
 Identities = 12/54 (22%), Positives = 25/54 (46%)
 Frame = +2

Query: 215 RLSVXRYHNRYCSRKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAA 376
           R ++ ++   YC+ K  T +Y    +D    R+F   +I       C +L++ +
Sbjct: 208 RFTLEKFFTDYCNSKTNTGEYSCLKVDLLFKREFSYYLI--QIYIPCCMLVIVS 259


>AB253417-1|BAE86928.1|  567|Apis mellifera alpha-glucosidase
           protein.
          Length = 567

 Score = 23.0 bits (47), Expect = 2.9
 Identities = 13/34 (38%), Positives = 18/34 (52%)
 Frame = +2

Query: 266 TSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLI 367
           T KYY    D P +  FIKN+   ++ +D   LI
Sbjct: 294 TMKYYDYGADFPFNFAFIKNVSRDSNSSDFKKLI 327


>D79208-1|BAA11466.1|  567|Apis mellifera alpha-glucosidase protein.
          Length = 567

 Score = 22.6 bits (46), Expect = 3.9
 Identities = 12/34 (35%), Positives = 18/34 (52%)
 Frame = +2

Query: 266 TSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLI 367
           T KYY    D P +  FIKN+   ++ +D   L+
Sbjct: 294 TMKYYDYGADFPFNFAFIKNVSRDSNSSDFKKLV 327


>AY569781-1|AAS75781.1|  461|Apis mellifera neuronal nicotinic
           acetylcholine Apisa7-2 subunit protein.
          Length = 461

 Score = 22.2 bits (45), Expect = 5.2
 Identities = 9/29 (31%), Positives = 14/29 (48%)
 Frame = -1

Query: 658 P*TKAFWLKLQHVVSVPSRNGHESDSSWV 572
           P    F L L H++ V  +N   + + WV
Sbjct: 30  PLAVVFGLSLHHIIDVDEKNQILTTNCWV 58


>AB204559-1|BAD89804.1|  832|Apis mellifera soluble guanylyl cyclase
           beta-3 protein.
          Length = 832

 Score = 21.8 bits (44), Expect = 6.8
 Identities = 6/14 (42%), Positives = 11/14 (78%)
 Frame = +1

Query: 601 FWMARRQHVGASTK 642
           +W+ +R+H  +STK
Sbjct: 593 YWLEKREHRSSSTK 606


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 203,507
Number of Sequences: 438
Number of extensions: 4178
Number of successful extensions: 30
Number of sequences better than 10.0: 12
Number of HSP's better than 10.0 without gapping: 18
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 26
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 22657590
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -