SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30098.Seq
         (617 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ667186-1|ABG75738.1|  447|Apis mellifera glutamate-gated chlor...    26   0.34 
DQ667185-1|ABG75737.1|  447|Apis mellifera glutamate-gated chlor...    26   0.34 
DQ666693-1|ABG29167.1|  250|Apis mellifera MAX dimerization prot...    25   0.59 
S78458-1|AAB34402.1|   46|Apis mellifera apamin protein.               23   3.2  

>DQ667186-1|ABG75738.1|  447|Apis mellifera glutamate-gated chloride
           channel protein.
          Length = 447

 Score = 25.8 bits (54), Expect = 0.34
 Identities = 12/25 (48%), Positives = 15/25 (60%)
 Frame = +3

Query: 528 LPPRRRNCCRPSLEKTKPRLPLRSK 602
           + PR++NCCR  L K     P RSK
Sbjct: 393 MQPRKKNCCRSWLSK----FPTRSK 413


>DQ667185-1|ABG75737.1|  447|Apis mellifera glutamate-gated chloride
           channel protein.
          Length = 447

 Score = 25.8 bits (54), Expect = 0.34
 Identities = 12/25 (48%), Positives = 15/25 (60%)
 Frame = +3

Query: 528 LPPRRRNCCRPSLEKTKPRLPLRSK 602
           + PR++NCCR  L K     P RSK
Sbjct: 393 MQPRKKNCCRSWLSK----FPTRSK 413


>DQ666693-1|ABG29167.1|  250|Apis mellifera MAX dimerization protein
           protein.
          Length = 250

 Score = 25.0 bits (52), Expect = 0.59
 Identities = 22/67 (32%), Positives = 31/67 (46%), Gaps = 8/67 (11%)
 Frame = +3

Query: 417 EYIHRKKAEK----ARTKMLSDQAEA--RRNKVKEARSA--ARNVLPPRRRNCCRPSLEK 572
           EYI R++ E     A T  + D      +R K K+++ +    N L   RR   R  LEK
Sbjct: 11  EYIERREREAEHGYASTMPMPDDMRTVTKRPKTKKSQGSRTTHNELEKNRRAHLRNCLEK 70

Query: 573 TKPRLPL 593
            K  +PL
Sbjct: 71  LKVLVPL 77


>S78458-1|AAB34402.1|   46|Apis mellifera apamin protein.
          Length = 46

 Score = 22.6 bits (46), Expect = 3.2
 Identities = 11/40 (27%), Positives = 20/40 (50%), Gaps = 4/40 (10%)
 Frame = -2

Query: 355 RCLSIFLAVLYFRSNFLRTL----CLCTHSSFCGIRALQY 248
           RC+ +FL+V+   S F+  +    C    ++ C  R  Q+
Sbjct: 6   RCIYLFLSVILITSYFVTPVMPCNCKAPETALCARRCQQH 45


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 170,345
Number of Sequences: 438
Number of extensions: 3768
Number of successful extensions: 5
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 18337950
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -