SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30079.Seq
         (413 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY703618-1|AAU12614.1|  136|Apis mellifera wingless protein.           24   0.59 
AY222546-1|AAP69221.1|  135|Apis mellifera wingless protein.           24   0.59 
EF625896-1|ABR45903.1|  683|Apis mellifera hexamerin protein.          22   3.2  
AY601637-1|AAT11850.1|  683|Apis mellifera hexamerin 70b protein.      22   3.2  
AF134821-1|AAD40236.1|  226|Apis mellifera hexamerin protein.          22   3.2  
AB167961-1|BAD51404.1|  554|Apis mellifera E74 protein.                21   7.3  
EF540769-1|ABQ14707.1|  620|Apis mellifera adenosine deaminase p...    20   9.6  

>AY703618-1|AAU12614.1|  136|Apis mellifera wingless protein.
          Length = 136

 Score = 24.2 bits (50), Expect = 0.59
 Identities = 9/20 (45%), Positives = 13/20 (65%)
 Frame = -3

Query: 309 KNATMNILIMHGNKCNNQSL 250
           KN  + IL  HG +CN+ S+
Sbjct: 89  KNPKLGILGTHGRQCNDTSI 108


>AY222546-1|AAP69221.1|  135|Apis mellifera wingless protein.
          Length = 135

 Score = 24.2 bits (50), Expect = 0.59
 Identities = 9/20 (45%), Positives = 13/20 (65%)
 Frame = -3

Query: 309 KNATMNILIMHGNKCNNQSL 250
           KN  + IL  HG +CN+ S+
Sbjct: 90  KNPKLGILGTHGRQCNDTSI 109


>EF625896-1|ABR45903.1|  683|Apis mellifera hexamerin protein.
          Length = 683

 Score = 21.8 bits (44), Expect = 3.2
 Identities = 12/40 (30%), Positives = 19/40 (47%)
 Frame = +3

Query: 282 LLVCSLLHFCYYXXISTSSLAVCLDLNNSHYRRPLFISTY 401
           LLV  +L F Y   +    +   L + ++  R P+F S Y
Sbjct: 382 LLVRKVLGFGYESNVKYQVVPSALQMWSTSLRDPVFFSIY 421


>AY601637-1|AAT11850.1|  683|Apis mellifera hexamerin 70b protein.
          Length = 683

 Score = 21.8 bits (44), Expect = 3.2
 Identities = 12/40 (30%), Positives = 19/40 (47%)
 Frame = +3

Query: 282 LLVCSLLHFCYYXXISTSSLAVCLDLNNSHYRRPLFISTY 401
           LLV  +L F Y   +    +   L + ++  R P+F S Y
Sbjct: 382 LLVRKVLGFGYESNVKYQVVPSALQMWSTSLRDPVFFSIY 421


>AF134821-1|AAD40236.1|  226|Apis mellifera hexamerin protein.
          Length = 226

 Score = 21.8 bits (44), Expect = 3.2
 Identities = 12/40 (30%), Positives = 19/40 (47%)
 Frame = +3

Query: 282 LLVCSLLHFCYYXXISTSSLAVCLDLNNSHYRRPLFISTY 401
           LLV  +L F Y   +    +   L + ++  R P+F S Y
Sbjct: 8   LLVRKVLGFGYESNVKYQVVPSALQMWSTSLRDPVFFSIY 47


>AB167961-1|BAD51404.1|  554|Apis mellifera E74 protein.
          Length = 554

 Score = 20.6 bits (41), Expect = 7.3
 Identities = 8/18 (44%), Positives = 12/18 (66%)
 Frame = +3

Query: 357 LNNSHYRRPLFISTYYAS 410
           L + HYR+P  +S  Y+S
Sbjct: 361 LQHLHYRQPPTLSESYSS 378


>EF540769-1|ABQ14707.1|  620|Apis mellifera adenosine deaminase
           protein.
          Length = 620

 Score = 20.2 bits (40), Expect = 9.6
 Identities = 7/13 (53%), Positives = 12/13 (92%)
 Frame = +3

Query: 267 IYFHALLVCSLLH 305
           IYFH++++ SLL+
Sbjct: 459 IYFHSIVLGSLLN 471


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 95,360
Number of Sequences: 438
Number of extensions: 1765
Number of successful extensions: 7
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 146,343
effective HSP length: 52
effective length of database: 123,567
effective search space used: 10503195
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)

- SilkBase 1999-2022 -