SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30074.Seq
         (450 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF625896-1|ABR45903.1|  683|Apis mellifera hexamerin protein.          23   1.5  
AY601637-1|AAT11850.1|  683|Apis mellifera hexamerin 70b protein.      23   1.5  
AF134821-1|AAD40236.1|  226|Apis mellifera hexamerin protein.          23   1.5  
AB167961-1|BAD51404.1|  554|Apis mellifera E74 protein.                23   1.5  
AY703618-1|AAU12614.1|  136|Apis mellifera wingless protein.           22   2.7  
AY222546-1|AAP69221.1|  135|Apis mellifera wingless protein.           22   2.7  

>EF625896-1|ABR45903.1|  683|Apis mellifera hexamerin protein.
          Length = 683

 Score = 23.0 bits (47), Expect = 1.5
 Identities = 14/49 (28%), Positives = 23/49 (46%)
 Frame = +2

Query: 284 LLVCSLLHFCYYIFISTSSLAVCLDLNNSHYRRPLFISTYYASIWYINK 430
           LLV  +L F Y   +    +   L + ++  R P+F S Y   + Y +K
Sbjct: 382 LLVRKVLGFGYESNVKYQVVPSALQMWSTSLRDPVFFSIYKTILDYYHK 430


>AY601637-1|AAT11850.1|  683|Apis mellifera hexamerin 70b protein.
          Length = 683

 Score = 23.0 bits (47), Expect = 1.5
 Identities = 14/49 (28%), Positives = 23/49 (46%)
 Frame = +2

Query: 284 LLVCSLLHFCYYIFISTSSLAVCLDLNNSHYRRPLFISTYYASIWYINK 430
           LLV  +L F Y   +    +   L + ++  R P+F S Y   + Y +K
Sbjct: 382 LLVRKVLGFGYESNVKYQVVPSALQMWSTSLRDPVFFSIYKTILDYYHK 430


>AF134821-1|AAD40236.1|  226|Apis mellifera hexamerin protein.
          Length = 226

 Score = 23.0 bits (47), Expect = 1.5
 Identities = 14/49 (28%), Positives = 23/49 (46%)
 Frame = +2

Query: 284 LLVCSLLHFCYYIFISTSSLAVCLDLNNSHYRRPLFISTYYASIWYINK 430
           LLV  +L F Y   +    +   L + ++  R P+F S Y   + Y +K
Sbjct: 8   LLVRKVLGFGYESNVKYQVVPSALQMWSTSLRDPVFFSIYKTILDYYHK 56


>AB167961-1|BAD51404.1|  554|Apis mellifera E74 protein.
          Length = 554

 Score = 23.0 bits (47), Expect = 1.5
 Identities = 11/26 (42%), Positives = 16/26 (61%)
 Frame = +2

Query: 359 LNNSHYRRPLFISTYYASIWYINK*Y 436
           L + HYR+P  +S  Y+S  Y+N  Y
Sbjct: 361 LQHLHYRQPPTLSESYSS--YVNSMY 384


>AY703618-1|AAU12614.1|  136|Apis mellifera wingless protein.
          Length = 136

 Score = 22.2 bits (45), Expect = 2.7
 Identities = 8/17 (47%), Positives = 11/17 (64%)
 Frame = -2

Query: 311 KNATMNILIMHGNKCNN 261
           KN  + IL  HG +CN+
Sbjct: 89  KNPKLGILGTHGRQCND 105


>AY222546-1|AAP69221.1|  135|Apis mellifera wingless protein.
          Length = 135

 Score = 22.2 bits (45), Expect = 2.7
 Identities = 8/17 (47%), Positives = 11/17 (64%)
 Frame = -2

Query: 311 KNATMNILIMHGNKCNN 261
           KN  + IL  HG +CN+
Sbjct: 90  KNPKLGILGTHGRQCND 106


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 112,362
Number of Sequences: 438
Number of extensions: 2113
Number of successful extensions: 7
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 146,343
effective HSP length: 53
effective length of database: 123,129
effective search space used: 11820384
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)

- SilkBase 1999-2022 -