SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30011.Seq
         (628 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB193550-1|BAD66824.1|  699|Apis mellifera soluble guanylyl cycl...    24   1.4  
AF084556-1|AAC71015.1|  652|Apis mellifera pipsqueak protein.          23   2.4  
DQ325067-1|ABD14081.1|  152|Apis mellifera complementary sex det...    23   3.2  
DQ325066-1|ABD14080.1|  152|Apis mellifera complementary sex det...    23   3.2  
DQ325065-1|ABD14079.1|  152|Apis mellifera complementary sex det...    23   3.2  
DQ325064-1|ABD14078.1|  152|Apis mellifera complementary sex det...    23   3.2  
DQ325063-1|ABD14077.1|  152|Apis mellifera complementary sex det...    23   3.2  
DQ325062-1|ABD14076.1|  152|Apis mellifera complementary sex det...    23   3.2  
DQ325061-1|ABD14075.1|  152|Apis mellifera complementary sex det...    23   3.2  
AY569719-1|AAS86672.1|  401|Apis mellifera feminizer protein.          23   3.2  
AY569718-1|AAS86671.1|  401|Apis mellifera feminizer protein.          23   3.2  
AY569715-1|AAS86668.1|  401|Apis mellifera feminizer protein.          23   3.2  
AY569714-1|AAS86667.1|  401|Apis mellifera feminizer protein.          23   3.2  
AY569713-1|AAS86666.1|  401|Apis mellifera feminizer protein.          23   3.2  
AY569711-1|AAS86664.1|  401|Apis mellifera feminizer protein.          23   3.2  
AY569702-1|AAS86655.1|  400|Apis mellifera feminizer protein.          23   3.2  
AY350616-1|AAQ57658.1|  401|Apis mellifera complementary sex det...    23   3.2  
DQ325089-1|ABD14103.1|  185|Apis mellifera complementary sex det...    21   7.4  
DQ325088-1|ABD14102.1|  185|Apis mellifera complementary sex det...    21   7.4  
DQ325132-1|ABD14146.1|  189|Apis mellifera complementary sex det...    21   9.8  
DQ325131-1|ABD14145.1|  189|Apis mellifera complementary sex det...    21   9.8  
DQ325124-1|ABD14138.1|  179|Apis mellifera complementary sex det...    21   9.8  
DQ325123-1|ABD14137.1|  179|Apis mellifera complementary sex det...    21   9.8  
DQ325122-1|ABD14136.1|  179|Apis mellifera complementary sex det...    21   9.8  
DQ325103-1|ABD14117.1|  182|Apis mellifera complementary sex det...    21   9.8  
DQ325102-1|ABD14116.1|  183|Apis mellifera complementary sex det...    21   9.8  
DQ325101-1|ABD14115.1|  182|Apis mellifera complementary sex det...    21   9.8  
DQ325100-1|ABD14114.1|  183|Apis mellifera complementary sex det...    21   9.8  
DQ325099-1|ABD14113.1|  183|Apis mellifera complementary sex det...    21   9.8  
DQ325098-1|ABD14112.1|  183|Apis mellifera complementary sex det...    21   9.8  
DQ325097-1|ABD14111.1|  183|Apis mellifera complementary sex det...    21   9.8  
DQ325096-1|ABD14110.1|  183|Apis mellifera complementary sex det...    21   9.8  
DQ325095-1|ABD14109.1|  183|Apis mellifera complementary sex det...    21   9.8  
DQ325087-1|ABD14101.1|  179|Apis mellifera complementary sex det...    21   9.8  
DQ325086-1|ABD14100.1|  179|Apis mellifera complementary sex det...    21   9.8  
DQ325085-1|ABD14099.1|  179|Apis mellifera complementary sex det...    21   9.8  
DQ325084-1|ABD14098.1|  179|Apis mellifera complementary sex det...    21   9.8  
DQ325077-1|ABD14091.1|  181|Apis mellifera complementary sex det...    21   9.8  
DQ325076-1|ABD14090.1|  191|Apis mellifera complementary sex det...    21   9.8  
AY569721-1|AAS86674.1|  400|Apis mellifera complementary sex det...    21   9.8  
AY569717-1|AAS86670.1|  397|Apis mellifera complementary sex det...    21   9.8  
AY569712-1|AAS86665.1|  408|Apis mellifera complementary sex det...    21   9.8  
AY569704-1|AAS86657.1|  426|Apis mellifera complementary sex det...    21   9.8  
AY569698-1|AAS86651.1|  407|Apis mellifera complementary sex det...    21   9.8  
AY569694-1|AAS86647.1|  400|Apis mellifera complementary sex det...    21   9.8  
AY395071-1|AAQ96727.1|  646|Apis mellifera GABA neurotransmitter...    21   9.8  
AY350618-1|AAQ57660.1|  425|Apis mellifera complementary sex det...    21   9.8  
AB231585-1|BAE17127.1|  898|Apis mellifera Mahya protein.              21   9.8  

>AB193550-1|BAD66824.1|  699|Apis mellifera soluble guanylyl cyclase
           alpha 1 subunit protein.
          Length = 699

 Score = 23.8 bits (49), Expect = 1.4
 Identities = 12/45 (26%), Positives = 16/45 (35%)
 Frame = +2

Query: 347 WQASGYCSTCSHWTXHHVRAALVTGGRHRSSRXCAVAKFQVPRTC 481
           W A      CSH   H  +   +  G H       V   ++PR C
Sbjct: 561 WMALKMIQACSHHLTHKGKPIRMRIGIHTGMVLAGVVGKKMPRYC 605


>AF084556-1|AAC71015.1|  652|Apis mellifera pipsqueak protein.
          Length = 652

 Score = 23.0 bits (47), Expect = 2.4
 Identities = 14/43 (32%), Positives = 18/43 (41%)
 Frame = +2

Query: 350 QASGYCSTCSHWTXHHVRAALVTGGRHRSSRXCAVAKFQVPRT 478
           Q+S +      WT   + AAL     H  S   A A F +P T
Sbjct: 400 QSSSHHHGSKSWTQEDMDAALEALRNHDMSLTKASATFGIPST 442


>DQ325067-1|ABD14081.1|  152|Apis mellifera complementary sex
           determiner protein.
          Length = 152

 Score = 22.6 bits (46), Expect = 3.2
 Identities = 12/26 (46%), Positives = 14/26 (53%), Gaps = 1/26 (3%)
 Frame = -1

Query: 163 HIR-RTPSARTVESRQRSLXSYPNRR 89
           H+R RT   R   SR+R   SY N R
Sbjct: 29  HLRERTSRRRYSRSREREQKSYKNER 54


>DQ325066-1|ABD14080.1|  152|Apis mellifera complementary sex
           determiner protein.
          Length = 152

 Score = 22.6 bits (46), Expect = 3.2
 Identities = 12/26 (46%), Positives = 14/26 (53%), Gaps = 1/26 (3%)
 Frame = -1

Query: 163 HIR-RTPSARTVESRQRSLXSYPNRR 89
           H+R RT   R   SR+R   SY N R
Sbjct: 29  HLRERTSRRRYSRSREREQKSYKNER 54


>DQ325065-1|ABD14079.1|  152|Apis mellifera complementary sex
           determiner protein.
          Length = 152

 Score = 22.6 bits (46), Expect = 3.2
 Identities = 12/26 (46%), Positives = 14/26 (53%), Gaps = 1/26 (3%)
 Frame = -1

Query: 163 HIR-RTPSARTVESRQRSLXSYPNRR 89
           H+R RT   R   SR+R   SY N R
Sbjct: 29  HLRERTSRRRYSRSREREQKSYKNER 54


>DQ325064-1|ABD14078.1|  152|Apis mellifera complementary sex
           determiner protein.
          Length = 152

 Score = 22.6 bits (46), Expect = 3.2
 Identities = 12/26 (46%), Positives = 14/26 (53%), Gaps = 1/26 (3%)
 Frame = -1

Query: 163 HIR-RTPSARTVESRQRSLXSYPNRR 89
           H+R RT   R   SR+R   SY N R
Sbjct: 29  HLRERTSRRRYSRSREREQKSYKNER 54


>DQ325063-1|ABD14077.1|  152|Apis mellifera complementary sex
           determiner protein.
          Length = 152

 Score = 22.6 bits (46), Expect = 3.2
 Identities = 12/26 (46%), Positives = 14/26 (53%), Gaps = 1/26 (3%)
 Frame = -1

Query: 163 HIR-RTPSARTVESRQRSLXSYPNRR 89
           H+R RT   R   SR+R   SY N R
Sbjct: 29  HLRERTSRRRYSRSREREQKSYKNER 54


>DQ325062-1|ABD14076.1|  152|Apis mellifera complementary sex
           determiner protein.
          Length = 152

 Score = 22.6 bits (46), Expect = 3.2
 Identities = 12/26 (46%), Positives = 14/26 (53%), Gaps = 1/26 (3%)
 Frame = -1

Query: 163 HIR-RTPSARTVESRQRSLXSYPNRR 89
           H+R RT   R   SR+R   SY N R
Sbjct: 29  HLRERTSRRRYSRSREREQKSYKNER 54


>DQ325061-1|ABD14075.1|  152|Apis mellifera complementary sex
           determiner protein.
          Length = 152

 Score = 22.6 bits (46), Expect = 3.2
 Identities = 12/26 (46%), Positives = 14/26 (53%), Gaps = 1/26 (3%)
 Frame = -1

Query: 163 HIR-RTPSARTVESRQRSLXSYPNRR 89
           H+R RT   R   SR+R   SY N R
Sbjct: 29  HLRERTSRRRYSRSREREQKSYKNER 54


>AY569719-1|AAS86672.1|  401|Apis mellifera feminizer protein.
          Length = 401

 Score = 22.6 bits (46), Expect = 3.2
 Identities = 12/26 (46%), Positives = 14/26 (53%), Gaps = 1/26 (3%)
 Frame = -1

Query: 163 HIR-RTPSARTVESRQRSLXSYPNRR 89
           H+R RT   R   SR+R   SY N R
Sbjct: 278 HLRERTSRRRYSRSREREQKSYKNER 303


>AY569718-1|AAS86671.1|  401|Apis mellifera feminizer protein.
          Length = 401

 Score = 22.6 bits (46), Expect = 3.2
 Identities = 12/26 (46%), Positives = 14/26 (53%), Gaps = 1/26 (3%)
 Frame = -1

Query: 163 HIR-RTPSARTVESRQRSLXSYPNRR 89
           H+R RT   R   SR+R   SY N R
Sbjct: 278 HLRERTSRRRYSRSREREQKSYKNER 303


>AY569715-1|AAS86668.1|  401|Apis mellifera feminizer protein.
          Length = 401

 Score = 22.6 bits (46), Expect = 3.2
 Identities = 12/26 (46%), Positives = 14/26 (53%), Gaps = 1/26 (3%)
 Frame = -1

Query: 163 HIR-RTPSARTVESRQRSLXSYPNRR 89
           H+R RT   R   SR+R   SY N R
Sbjct: 278 HLRERTSRRRYSRSREREQKSYKNER 303


>AY569714-1|AAS86667.1|  401|Apis mellifera feminizer protein.
          Length = 401

 Score = 22.6 bits (46), Expect = 3.2
 Identities = 12/26 (46%), Positives = 14/26 (53%), Gaps = 1/26 (3%)
 Frame = -1

Query: 163 HIR-RTPSARTVESRQRSLXSYPNRR 89
           H+R RT   R   SR+R   SY N R
Sbjct: 278 HLRERTSRRRYSRSREREQKSYKNER 303


>AY569713-1|AAS86666.1|  401|Apis mellifera feminizer protein.
          Length = 401

 Score = 22.6 bits (46), Expect = 3.2
 Identities = 12/26 (46%), Positives = 14/26 (53%), Gaps = 1/26 (3%)
 Frame = -1

Query: 163 HIR-RTPSARTVESRQRSLXSYPNRR 89
           H+R RT   R   SR+R   SY N R
Sbjct: 278 HLRERTSRRRYSRSREREQKSYKNER 303


>AY569711-1|AAS86664.1|  401|Apis mellifera feminizer protein.
          Length = 401

 Score = 22.6 bits (46), Expect = 3.2
 Identities = 12/26 (46%), Positives = 14/26 (53%), Gaps = 1/26 (3%)
 Frame = -1

Query: 163 HIR-RTPSARTVESRQRSLXSYPNRR 89
           H+R RT   R   SR+R   SY N R
Sbjct: 278 HLRERTSRRRYSRSREREQKSYKNER 303


>AY569702-1|AAS86655.1|  400|Apis mellifera feminizer protein.
          Length = 400

 Score = 22.6 bits (46), Expect = 3.2
 Identities = 12/26 (46%), Positives = 14/26 (53%), Gaps = 1/26 (3%)
 Frame = -1

Query: 163 HIR-RTPSARTVESRQRSLXSYPNRR 89
           H+R RT   R   SR+R   SY N R
Sbjct: 277 HLRERTSRRRYSRSREREQKSYKNER 302


>AY350616-1|AAQ57658.1|  401|Apis mellifera complementary sex
           determiner protein.
          Length = 401

 Score = 22.6 bits (46), Expect = 3.2
 Identities = 12/26 (46%), Positives = 14/26 (53%), Gaps = 1/26 (3%)
 Frame = -1

Query: 163 HIR-RTPSARTVESRQRSLXSYPNRR 89
           H+R RT   R   SR+R   SY N R
Sbjct: 278 HLRERTSRRRYSRSREREQKSYKNER 303


>DQ325089-1|ABD14103.1|  185|Apis mellifera complementary sex
           determiner protein.
          Length = 185

 Score = 21.4 bits (43), Expect = 7.4
 Identities = 10/22 (45%), Positives = 11/22 (50%)
 Frame = -1

Query: 154 RTPSARTVESRQRSLXSYPNRR 89
           RT   R   SR+R   SY N R
Sbjct: 32  RTNRKRNSRSREREQNSYKNER 53


>DQ325088-1|ABD14102.1|  185|Apis mellifera complementary sex
           determiner protein.
          Length = 185

 Score = 21.4 bits (43), Expect = 7.4
 Identities = 10/22 (45%), Positives = 11/22 (50%)
 Frame = -1

Query: 154 RTPSARTVESRQRSLXSYPNRR 89
           RT   R   SR+R   SY N R
Sbjct: 32  RTNRKRNSRSREREQNSYKNER 53


>DQ325132-1|ABD14146.1|  189|Apis mellifera complementary sex
           determiner protein.
          Length = 189

 Score = 21.0 bits (42), Expect = 9.8
 Identities = 10/22 (45%), Positives = 11/22 (50%)
 Frame = -1

Query: 154 RTPSARTVESRQRSLXSYPNRR 89
           RT   R   SR+R   SY N R
Sbjct: 33  RTSRKRYSRSREREQKSYKNER 54


>DQ325131-1|ABD14145.1|  189|Apis mellifera complementary sex
           determiner protein.
          Length = 189

 Score = 21.0 bits (42), Expect = 9.8
 Identities = 10/22 (45%), Positives = 11/22 (50%)
 Frame = -1

Query: 154 RTPSARTVESRQRSLXSYPNRR 89
           RT   R   SR+R   SY N R
Sbjct: 33  RTSRKRYSRSREREQKSYKNER 54


>DQ325124-1|ABD14138.1|  179|Apis mellifera complementary sex
           determiner protein.
          Length = 179

 Score = 21.0 bits (42), Expect = 9.8
 Identities = 10/22 (45%), Positives = 11/22 (50%)
 Frame = -1

Query: 154 RTPSARTVESRQRSLXSYPNRR 89
           RT   R   SR+R   SY N R
Sbjct: 33  RTSRKRYSRSREREQNSYKNER 54


>DQ325123-1|ABD14137.1|  179|Apis mellifera complementary sex
           determiner protein.
          Length = 179

 Score = 21.0 bits (42), Expect = 9.8
 Identities = 10/22 (45%), Positives = 11/22 (50%)
 Frame = -1

Query: 154 RTPSARTVESRQRSLXSYPNRR 89
           RT   R   SR+R   SY N R
Sbjct: 33  RTSRKRYSRSREREQNSYKNER 54


>DQ325122-1|ABD14136.1|  179|Apis mellifera complementary sex
           determiner protein.
          Length = 179

 Score = 21.0 bits (42), Expect = 9.8
 Identities = 10/22 (45%), Positives = 11/22 (50%)
 Frame = -1

Query: 154 RTPSARTVESRQRSLXSYPNRR 89
           RT   R   SR+R   SY N R
Sbjct: 33  RTSRKRYSRSREREQNSYKNER 54


>DQ325103-1|ABD14117.1|  182|Apis mellifera complementary sex
           determiner protein.
          Length = 182

 Score = 21.0 bits (42), Expect = 9.8
 Identities = 10/22 (45%), Positives = 11/22 (50%)
 Frame = -1

Query: 154 RTPSARTVESRQRSLXSYPNRR 89
           RT   R   SR+R   SY N R
Sbjct: 33  RTSRKRYSRSREREQNSYKNER 54


>DQ325102-1|ABD14116.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 21.0 bits (42), Expect = 9.8
 Identities = 10/22 (45%), Positives = 11/22 (50%)
 Frame = -1

Query: 154 RTPSARTVESRQRSLXSYPNRR 89
           RT   R   SR+R   SY N R
Sbjct: 33  RTSRKRYSRSREREQNSYKNER 54


>DQ325101-1|ABD14115.1|  182|Apis mellifera complementary sex
           determiner protein.
          Length = 182

 Score = 21.0 bits (42), Expect = 9.8
 Identities = 10/22 (45%), Positives = 11/22 (50%)
 Frame = -1

Query: 154 RTPSARTVESRQRSLXSYPNRR 89
           RT   R   SR+R   SY N R
Sbjct: 33  RTSRKRYSRSREREQNSYKNER 54


>DQ325100-1|ABD14114.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 21.0 bits (42), Expect = 9.8
 Identities = 10/22 (45%), Positives = 11/22 (50%)
 Frame = -1

Query: 154 RTPSARTVESRQRSLXSYPNRR 89
           RT   R   SR+R   SY N R
Sbjct: 33  RTSRKRYSRSREREQNSYKNER 54


>DQ325099-1|ABD14113.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 21.0 bits (42), Expect = 9.8
 Identities = 10/22 (45%), Positives = 11/22 (50%)
 Frame = -1

Query: 154 RTPSARTVESRQRSLXSYPNRR 89
           RT   R   SR+R   SY N R
Sbjct: 33  RTSRKRYSRSREREQNSYKNER 54


>DQ325098-1|ABD14112.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 21.0 bits (42), Expect = 9.8
 Identities = 10/22 (45%), Positives = 11/22 (50%)
 Frame = -1

Query: 154 RTPSARTVESRQRSLXSYPNRR 89
           RT   R   SR+R   SY N R
Sbjct: 33  RTSRKRYSRSREREQNSYKNER 54


>DQ325097-1|ABD14111.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 21.0 bits (42), Expect = 9.8
 Identities = 10/22 (45%), Positives = 11/22 (50%)
 Frame = -1

Query: 154 RTPSARTVESRQRSLXSYPNRR 89
           RT   R   SR+R   SY N R
Sbjct: 33  RTSRKRYSRSREREQNSYKNER 54


>DQ325096-1|ABD14110.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 21.0 bits (42), Expect = 9.8
 Identities = 10/22 (45%), Positives = 11/22 (50%)
 Frame = -1

Query: 154 RTPSARTVESRQRSLXSYPNRR 89
           RT   R   SR+R   SY N R
Sbjct: 33  RTSRKRYSRSREREQNSYKNER 54


>DQ325095-1|ABD14109.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 21.0 bits (42), Expect = 9.8
 Identities = 10/22 (45%), Positives = 11/22 (50%)
 Frame = -1

Query: 154 RTPSARTVESRQRSLXSYPNRR 89
           RT   R   SR+R   SY N R
Sbjct: 33  RTSRKRYSRSREREQNSYKNER 54


>DQ325087-1|ABD14101.1|  179|Apis mellifera complementary sex
           determiner protein.
          Length = 179

 Score = 21.0 bits (42), Expect = 9.8
 Identities = 10/22 (45%), Positives = 11/22 (50%)
 Frame = -1

Query: 154 RTPSARTVESRQRSLXSYPNRR 89
           RT   R   SR+R   SY N R
Sbjct: 33  RTSRKRYSRSREREQNSYKNER 54


>DQ325086-1|ABD14100.1|  179|Apis mellifera complementary sex
           determiner protein.
          Length = 179

 Score = 21.0 bits (42), Expect = 9.8
 Identities = 10/22 (45%), Positives = 11/22 (50%)
 Frame = -1

Query: 154 RTPSARTVESRQRSLXSYPNRR 89
           RT   R   SR+R   SY N R
Sbjct: 33  RTSRKRYSRSREREQNSYKNER 54


>DQ325085-1|ABD14099.1|  179|Apis mellifera complementary sex
           determiner protein.
          Length = 179

 Score = 21.0 bits (42), Expect = 9.8
 Identities = 10/22 (45%), Positives = 11/22 (50%)
 Frame = -1

Query: 154 RTPSARTVESRQRSLXSYPNRR 89
           RT   R   SR+R   SY N R
Sbjct: 33  RTSRKRYSRSREREQNSYKNER 54


>DQ325084-1|ABD14098.1|  179|Apis mellifera complementary sex
           determiner protein.
          Length = 179

 Score = 21.0 bits (42), Expect = 9.8
 Identities = 10/22 (45%), Positives = 11/22 (50%)
 Frame = -1

Query: 154 RTPSARTVESRQRSLXSYPNRR 89
           RT   R   SR+R   SY N R
Sbjct: 33  RTSRKRYSRSREREQNSYKNER 54


>DQ325077-1|ABD14091.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.0 bits (42), Expect = 9.8
 Identities = 10/22 (45%), Positives = 11/22 (50%)
 Frame = -1

Query: 154 RTPSARTVESRQRSLXSYPNRR 89
           RT   R   SR+R   SY N R
Sbjct: 33  RTSRKRYSRSREREQKSYKNER 54


>DQ325076-1|ABD14090.1|  191|Apis mellifera complementary sex
           determiner protein.
          Length = 191

 Score = 21.0 bits (42), Expect = 9.8
 Identities = 10/22 (45%), Positives = 11/22 (50%)
 Frame = -1

Query: 154 RTPSARTVESRQRSLXSYPNRR 89
           RT   R   SR+R   SY N R
Sbjct: 33  RTSRKRYSRSREREQKSYKNER 54


>AY569721-1|AAS86674.1|  400|Apis mellifera complementary sex
           determiner protein.
          Length = 400

 Score = 21.0 bits (42), Expect = 9.8
 Identities = 10/22 (45%), Positives = 11/22 (50%)
 Frame = -1

Query: 154 RTPSARTVESRQRSLXSYPNRR 89
           RT   R   SR+R   SY N R
Sbjct: 255 RTSRKRYSRSREREQNSYKNER 276


>AY569717-1|AAS86670.1|  397|Apis mellifera complementary sex
           determiner protein.
          Length = 397

 Score = 21.0 bits (42), Expect = 9.8
 Identities = 10/22 (45%), Positives = 11/22 (50%)
 Frame = -1

Query: 154 RTPSARTVESRQRSLXSYPNRR 89
           RT   R   SR+R   SY N R
Sbjct: 255 RTSRKRYSRSREREQNSYKNER 276


>AY569712-1|AAS86665.1|  408|Apis mellifera complementary sex
           determiner protein.
          Length = 408

 Score = 21.0 bits (42), Expect = 9.8
 Identities = 10/22 (45%), Positives = 11/22 (50%)
 Frame = -1

Query: 154 RTPSARTVESRQRSLXSYPNRR 89
           RT   R   SR+R   SY N R
Sbjct: 266 RTSRKRYSRSREREQNSYKNER 287


>AY569704-1|AAS86657.1|  426|Apis mellifera complementary sex
           determiner protein.
          Length = 426

 Score = 21.0 bits (42), Expect = 9.8
 Identities = 10/22 (45%), Positives = 11/22 (50%)
 Frame = -1

Query: 154 RTPSARTVESRQRSLXSYPNRR 89
           RT   R   SR+R   SY N R
Sbjct: 266 RTSRKRYSRSREREQNSYKNER 287


>AY569698-1|AAS86651.1|  407|Apis mellifera complementary sex
           determiner protein.
          Length = 407

 Score = 21.0 bits (42), Expect = 9.8
 Identities = 10/22 (45%), Positives = 11/22 (50%)
 Frame = -1

Query: 154 RTPSARTVESRQRSLXSYPNRR 89
           RT   R   SR+R   SY N R
Sbjct: 266 RTSHKRYSRSREREQKSYKNER 287


>AY569694-1|AAS86647.1|  400|Apis mellifera complementary sex
           determiner protein.
          Length = 400

 Score = 21.0 bits (42), Expect = 9.8
 Identities = 10/22 (45%), Positives = 11/22 (50%)
 Frame = -1

Query: 154 RTPSARTVESRQRSLXSYPNRR 89
           RT   R   SR+R   SY N R
Sbjct: 255 RTSRKRYSRSREREQKSYKNER 276


>AY395071-1|AAQ96727.1|  646|Apis mellifera GABA neurotransmitter
           transporter-1B protein.
          Length = 646

 Score = 21.0 bits (42), Expect = 9.8
 Identities = 8/15 (53%), Positives = 9/15 (60%)
 Frame = +2

Query: 239 ISSISDETSPFPRYP 283
           IS +   TSP PR P
Sbjct: 9   ISKVDRSTSPLPRKP 23


>AY350618-1|AAQ57660.1|  425|Apis mellifera complementary sex
           determiner protein.
          Length = 425

 Score = 21.0 bits (42), Expect = 9.8
 Identities = 10/22 (45%), Positives = 11/22 (50%)
 Frame = -1

Query: 154 RTPSARTVESRQRSLXSYPNRR 89
           RT   R   SR+R   SY N R
Sbjct: 266 RTSRERYSRSREREQKSYKNER 287


>AB231585-1|BAE17127.1|  898|Apis mellifera Mahya protein.
          Length = 898

 Score = 21.0 bits (42), Expect = 9.8
 Identities = 9/25 (36%), Positives = 11/25 (44%)
 Frame = -1

Query: 163 HIRRTPSARTVESRQRSLXSYPNRR 89
           HIRRT        +   + SYP  R
Sbjct: 159 HIRRTLHMNRTSLKTSKIVSYPKSR 183


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 156,193
Number of Sequences: 438
Number of extensions: 3155
Number of successful extensions: 55
Number of sequences better than 10.0: 48
Number of HSP's better than 10.0 without gapping: 55
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 55
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 18704709
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -