SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B18
         (656 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ325113-1|ABD14127.1|  185|Apis mellifera complementary sex det...    23   0.084
DQ325112-1|ABD14126.1|  185|Apis mellifera complementary sex det...    23   0.084
DQ325111-1|ABD14125.1|  185|Apis mellifera complementary sex det...    23   0.084
DQ325110-1|ABD14124.1|  185|Apis mellifera complementary sex det...    23   0.084
AY569705-1|AAS86658.1|  419|Apis mellifera complementary sex det...    27   0.12 
AY350618-1|AAQ57660.1|  425|Apis mellifera complementary sex det...    23   0.47 
DQ325121-1|ABD14135.1|  181|Apis mellifera complementary sex det...    25   0.48 
DQ325120-1|ABD14134.1|  181|Apis mellifera complementary sex det...    25   0.48 
DQ325119-1|ABD14133.1|  181|Apis mellifera complementary sex det...    25   0.48 
DQ325118-1|ABD14132.1|  181|Apis mellifera complementary sex det...    25   0.48 
DQ325117-1|ABD14131.1|  181|Apis mellifera complementary sex det...    25   0.48 
DQ325116-1|ABD14130.1|  181|Apis mellifera complementary sex det...    25   0.48 
DQ325114-1|ABD14128.1|  181|Apis mellifera complementary sex det...    25   0.48 
DQ325090-1|ABD14104.1|  178|Apis mellifera complementary sex det...    24   1.1  
DQ325132-1|ABD14146.1|  189|Apis mellifera complementary sex det...    23   2.6  
DQ325131-1|ABD14145.1|  189|Apis mellifera complementary sex det...    23   2.6  
DQ325103-1|ABD14117.1|  182|Apis mellifera complementary sex det...    22   4.5  
DQ325102-1|ABD14116.1|  183|Apis mellifera complementary sex det...    22   4.5  
DQ325101-1|ABD14115.1|  182|Apis mellifera complementary sex det...    22   4.5  
DQ325100-1|ABD14114.1|  183|Apis mellifera complementary sex det...    22   4.5  
DQ325099-1|ABD14113.1|  183|Apis mellifera complementary sex det...    22   4.5  
DQ325098-1|ABD14112.1|  183|Apis mellifera complementary sex det...    22   4.5  
DQ325097-1|ABD14111.1|  183|Apis mellifera complementary sex det...    22   4.5  
DQ325096-1|ABD14110.1|  183|Apis mellifera complementary sex det...    22   4.5  
DQ325095-1|ABD14109.1|  183|Apis mellifera complementary sex det...    22   4.5  
AJ849455-1|CAH60991.1|  366|Apis mellifera twist protein protein.      22   4.5  
AY268031-1|AAP23056.1|  810|Apis mellifera dorsal protein splice...    22   5.9  

>DQ325113-1|ABD14127.1|  185|Apis mellifera complementary sex
           determiner protein.
          Length = 185

 Score = 23.4 bits (48), Expect(2) = 0.084
 Identities = 8/23 (34%), Positives = 11/23 (47%)
 Frame = +2

Query: 260 YSNYNNVETKQHRGSQYSFQLFY 328
           YSNYNN     +  + Y    +Y
Sbjct: 91  YSNYNNYNNNNYNNNNYKKLQYY 113



 Score = 23.0 bits (47), Expect(2) = 0.084
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = +2

Query: 239 NKRRYDSYSNYNN 277
           N  +Y +Y+NYNN
Sbjct: 87  NNYKYSNYNNYNN 99


>DQ325112-1|ABD14126.1|  185|Apis mellifera complementary sex
           determiner protein.
          Length = 185

 Score = 23.4 bits (48), Expect(2) = 0.084
 Identities = 8/23 (34%), Positives = 11/23 (47%)
 Frame = +2

Query: 260 YSNYNNVETKQHRGSQYSFQLFY 328
           YSNYNN     +  + Y    +Y
Sbjct: 91  YSNYNNYNNNNYNNNNYKKLQYY 113



 Score = 23.0 bits (47), Expect(2) = 0.084
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = +2

Query: 239 NKRRYDSYSNYNN 277
           N  +Y +Y+NYNN
Sbjct: 87  NNYKYSNYNNYNN 99


>DQ325111-1|ABD14125.1|  185|Apis mellifera complementary sex
           determiner protein.
          Length = 185

 Score = 23.4 bits (48), Expect(2) = 0.084
 Identities = 8/23 (34%), Positives = 11/23 (47%)
 Frame = +2

Query: 260 YSNYNNVETKQHRGSQYSFQLFY 328
           YSNYNN     +  + Y    +Y
Sbjct: 91  YSNYNNYNNNNYNNNNYKKLQYY 113



 Score = 23.0 bits (47), Expect(2) = 0.084
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = +2

Query: 239 NKRRYDSYSNYNN 277
           N  +Y +Y+NYNN
Sbjct: 87  NNYKYSNYNNYNN 99


>DQ325110-1|ABD14124.1|  185|Apis mellifera complementary sex
           determiner protein.
          Length = 185

 Score = 23.4 bits (48), Expect(2) = 0.084
 Identities = 8/23 (34%), Positives = 11/23 (47%)
 Frame = +2

Query: 260 YSNYNNVETKQHRGSQYSFQLFY 328
           YSNYNN     +  + Y    +Y
Sbjct: 91  YSNYNNYNNNNYNNNNYKKLQYY 113



 Score = 23.0 bits (47), Expect(2) = 0.084
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = +2

Query: 239 NKRRYDSYSNYNN 277
           N  +Y +Y+NYNN
Sbjct: 87  NNYKYSNYNNYNN 99


>AY569705-1|AAS86658.1|  419|Apis mellifera complementary sex
           determiner protein.
          Length = 419

 Score = 27.5 bits (58), Expect = 0.12
 Identities = 11/32 (34%), Positives = 19/32 (59%)
 Frame = +2

Query: 239 NKRRYDSYSNYNNVETKQHRGSQYSFQLFY*N 334
           N  +Y +Y+NYNN     +  + Y+ +L+Y N
Sbjct: 320 NNYKYSNYNNYNNYNNNNY--NNYNKKLYYKN 349


>AY350618-1|AAQ57660.1|  425|Apis mellifera complementary sex
           determiner protein.
          Length = 425

 Score = 23.0 bits (47), Expect(2) = 0.47
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = +2

Query: 239 NKRRYDSYSNYNN 277
           N  +Y +Y+NYNN
Sbjct: 320 NNYKYSNYNNYNN 332



 Score = 22.6 bits (46), Expect = 3.4
 Identities = 9/26 (34%), Positives = 15/26 (57%)
 Frame = +2

Query: 236 YNKRRYDSYSNYNNVETKQHRGSQYS 313
           YN   Y++Y+NYNN     ++   Y+
Sbjct: 330 YNNN-YNNYNNYNNNYNNNYKKLYYN 354



 Score = 20.6 bits (41), Expect(2) = 0.47
 Identities = 7/18 (38%), Positives = 10/18 (55%)
 Frame = +2

Query: 260 YSNYNNVETKQHRGSQYS 313
           YSNYNN     +  + Y+
Sbjct: 324 YSNYNNYNNNYNNYNNYN 341


>DQ325121-1|ABD14135.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 25.4 bits (53), Expect = 0.48
 Identities = 9/24 (37%), Positives = 14/24 (58%)
 Frame = +2

Query: 239 NKRRYDSYSNYNNVETKQHRGSQY 310
           N  +Y +Y+NYNN     ++  QY
Sbjct: 87  NNYKYSNYNNYNNNYNTNYKKLQY 110


>DQ325120-1|ABD14134.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 25.4 bits (53), Expect = 0.48
 Identities = 9/24 (37%), Positives = 14/24 (58%)
 Frame = +2

Query: 239 NKRRYDSYSNYNNVETKQHRGSQY 310
           N  +Y +Y+NYNN     ++  QY
Sbjct: 87  NNYKYSNYNNYNNNYNTNYKKLQY 110


>DQ325119-1|ABD14133.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 25.4 bits (53), Expect = 0.48
 Identities = 9/24 (37%), Positives = 14/24 (58%)
 Frame = +2

Query: 239 NKRRYDSYSNYNNVETKQHRGSQY 310
           N  +Y +Y+NYNN     ++  QY
Sbjct: 87  NNYKYSNYNNYNNNYNTNYKKLQY 110


>DQ325118-1|ABD14132.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 25.4 bits (53), Expect = 0.48
 Identities = 9/24 (37%), Positives = 14/24 (58%)
 Frame = +2

Query: 239 NKRRYDSYSNYNNVETKQHRGSQY 310
           N  +Y +Y+NYNN     ++  QY
Sbjct: 87  NNYKYSNYNNYNNNYNTNYKKLQY 110


>DQ325117-1|ABD14131.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 25.4 bits (53), Expect = 0.48
 Identities = 9/24 (37%), Positives = 14/24 (58%)
 Frame = +2

Query: 239 NKRRYDSYSNYNNVETKQHRGSQY 310
           N  +Y +Y+NYNN     ++  QY
Sbjct: 87  NNYKYSNYNNYNNNYNTNYKKLQY 110


>DQ325116-1|ABD14130.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 25.4 bits (53), Expect = 0.48
 Identities = 9/24 (37%), Positives = 14/24 (58%)
 Frame = +2

Query: 239 NKRRYDSYSNYNNVETKQHRGSQY 310
           N  +Y +Y+NYNN     ++  QY
Sbjct: 87  NNYKYSNYNNYNNNYNTNYKKLQY 110


>DQ325114-1|ABD14128.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 25.4 bits (53), Expect = 0.48
 Identities = 9/24 (37%), Positives = 14/24 (58%)
 Frame = +2

Query: 239 NKRRYDSYSNYNNVETKQHRGSQY 310
           N  +Y +Y+NYNN     ++  QY
Sbjct: 87  NNYKYSNYNNYNNNYNTNYKKLQY 110


>DQ325090-1|ABD14104.1|  178|Apis mellifera complementary sex
           determiner protein.
          Length = 178

 Score = 24.2 bits (50), Expect = 1.1
 Identities = 8/17 (47%), Positives = 11/17 (64%)
 Frame = +2

Query: 239 NKRRYDSYSNYNNVETK 289
           N  +Y +Y+NYNN   K
Sbjct: 87  NNYKYSNYNNYNNYNKK 103


>DQ325132-1|ABD14146.1|  189|Apis mellifera complementary sex
           determiner protein.
          Length = 189

 Score = 23.0 bits (47), Expect = 2.6
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = +2

Query: 239 NKRRYDSYSNYNN 277
           N  +Y +Y+NYNN
Sbjct: 87  NNYKYSNYNNYNN 99


>DQ325131-1|ABD14145.1|  189|Apis mellifera complementary sex
           determiner protein.
          Length = 189

 Score = 23.0 bits (47), Expect = 2.6
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = +2

Query: 239 NKRRYDSYSNYNN 277
           N  +Y +Y+NYNN
Sbjct: 87  NNYKYSNYNNYNN 99


>DQ325103-1|ABD14117.1|  182|Apis mellifera complementary sex
           determiner protein.
          Length = 182

 Score = 22.2 bits (45), Expect = 4.5
 Identities = 7/13 (53%), Positives = 9/13 (69%)
 Frame = +2

Query: 239 NKRRYDSYSNYNN 277
           N   Y +Y+NYNN
Sbjct: 87  NNYNYSNYNNYNN 99


>DQ325102-1|ABD14116.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 22.2 bits (45), Expect = 4.5
 Identities = 7/13 (53%), Positives = 9/13 (69%)
 Frame = +2

Query: 239 NKRRYDSYSNYNN 277
           N   Y +Y+NYNN
Sbjct: 87  NNYNYSNYNNYNN 99


>DQ325101-1|ABD14115.1|  182|Apis mellifera complementary sex
           determiner protein.
          Length = 182

 Score = 22.2 bits (45), Expect = 4.5
 Identities = 7/13 (53%), Positives = 9/13 (69%)
 Frame = +2

Query: 239 NKRRYDSYSNYNN 277
           N   Y +Y+NYNN
Sbjct: 87  NNYNYSNYNNYNN 99


>DQ325100-1|ABD14114.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 22.2 bits (45), Expect = 4.5
 Identities = 7/13 (53%), Positives = 9/13 (69%)
 Frame = +2

Query: 239 NKRRYDSYSNYNN 277
           N   Y +Y+NYNN
Sbjct: 87  NNYNYSNYNNYNN 99


>DQ325099-1|ABD14113.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 22.2 bits (45), Expect = 4.5
 Identities = 7/13 (53%), Positives = 9/13 (69%)
 Frame = +2

Query: 239 NKRRYDSYSNYNN 277
           N   Y +Y+NYNN
Sbjct: 87  NNYNYSNYNNYNN 99


>DQ325098-1|ABD14112.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 22.2 bits (45), Expect = 4.5
 Identities = 7/13 (53%), Positives = 9/13 (69%)
 Frame = +2

Query: 239 NKRRYDSYSNYNN 277
           N   Y +Y+NYNN
Sbjct: 87  NNYNYSNYNNYNN 99


>DQ325097-1|ABD14111.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 22.2 bits (45), Expect = 4.5
 Identities = 7/13 (53%), Positives = 9/13 (69%)
 Frame = +2

Query: 239 NKRRYDSYSNYNN 277
           N   Y +Y+NYNN
Sbjct: 87  NNYNYSNYNNYNN 99


>DQ325096-1|ABD14110.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 22.2 bits (45), Expect = 4.5
 Identities = 7/13 (53%), Positives = 9/13 (69%)
 Frame = +2

Query: 239 NKRRYDSYSNYNN 277
           N   Y +Y+NYNN
Sbjct: 87  NNYNYSNYNNYNN 99


>DQ325095-1|ABD14109.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 22.2 bits (45), Expect = 4.5
 Identities = 7/13 (53%), Positives = 9/13 (69%)
 Frame = +2

Query: 239 NKRRYDSYSNYNN 277
           N   Y +Y+NYNN
Sbjct: 87  NNYNYSNYNNYNN 99


>AJ849455-1|CAH60991.1|  366|Apis mellifera twist protein protein.
          Length = 366

 Score = 22.2 bits (45), Expect = 4.5
 Identities = 13/54 (24%), Positives = 27/54 (50%)
 Frame = +1

Query: 421 HLENKKRERQITPSPELKKASSDEEEVISLPTKRKRIRLNPVDSDDSDVENKAD 582
           H  ++++   +TPSP++   SS  EE+    + +    ++ V+     +E K D
Sbjct: 131 HSRDQEQNLYLTPSPQM--YSSGGEEITPRQSHQSYHHMDSVEYKPEIMEYKPD 182


>AY268031-1|AAP23056.1|  810|Apis mellifera dorsal protein splice
           variant B protein.
          Length = 810

 Score = 21.8 bits (44), Expect = 5.9
 Identities = 9/15 (60%), Positives = 10/15 (66%)
 Frame = +2

Query: 245 RRYDSYSNYNNVETK 289
           R Y SY NY + ETK
Sbjct: 452 RMYKSYPNYIDKETK 466


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 157,727
Number of Sequences: 438
Number of extensions: 3374
Number of successful extensions: 43
Number of sequences better than 10.0: 27
Number of HSP's better than 10.0 without gapping: 36
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 43
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 19734030
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -