SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B14
         (558 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ015969-1|AAY81926.1|  397|Apis mellifera stargazin related pro...    23   1.6  
AF069739-1|AAC63272.2|  690|Apis mellifera translation initiatio...    23   1.6  
AY336529-1|AAQ02340.1|  712|Apis mellifera transferrin protein.        23   2.8  
AY336528-1|AAQ02339.1|  712|Apis mellifera transferrin protein.        23   2.8  
AY217097-1|AAO39761.1|  712|Apis mellifera transferrin protein.        23   2.8  
DQ667183-1|ABG75735.1|  463|Apis mellifera GABA-gated ion channe...    22   4.8  
AY569717-1|AAS86670.1|  397|Apis mellifera complementary sex det...    22   4.8  
AY569712-1|AAS86665.1|  408|Apis mellifera complementary sex det...    22   4.8  
AY569704-1|AAS86657.1|  426|Apis mellifera complementary sex det...    22   4.8  
AY569703-1|AAS86656.1|  396|Apis mellifera complementary sex det...    22   4.8  
AY569701-1|AAS86654.1|  407|Apis mellifera complementary sex det...    22   4.8  
AY569700-1|AAS86653.1|  407|Apis mellifera complementary sex det...    22   4.8  
AY569699-1|AAS86652.1|  396|Apis mellifera complementary sex det...    22   4.8  
AY352276-1|AAQ67417.1|  385|Apis mellifera complementary sex det...    22   4.8  
AY350617-1|AAQ57659.1|  428|Apis mellifera complementary sex det...    22   4.8  

>DQ015969-1|AAY81926.1|  397|Apis mellifera stargazin related
           protein STG-1 protein.
          Length = 397

 Score = 23.4 bits (48), Expect = 1.6
 Identities = 6/7 (85%), Positives = 6/7 (85%)
 Frame = +1

Query: 430 SCCPWCC 450
           SCC WCC
Sbjct: 10  SCCCWCC 16


>AF069739-1|AAC63272.2|  690|Apis mellifera translation initiation
           factor 2 protein.
          Length = 690

 Score = 23.4 bits (48), Expect = 1.6
 Identities = 13/37 (35%), Positives = 17/37 (45%), Gaps = 2/37 (5%)
 Frame = +2

Query: 128 KDYHAPKHTELEKI--PNLQVIKAMQSLKSRGYVKEQ 232
           KD   P    + KI  PN+ +IK    L   G V E+
Sbjct: 242 KDAKVPIIVAINKIDKPNIDIIKVQYELAKHGIVIEE 278


>AY336529-1|AAQ02340.1|  712|Apis mellifera transferrin protein.
          Length = 712

 Score = 22.6 bits (46), Expect = 2.8
 Identities = 8/17 (47%), Positives = 10/17 (58%)
 Frame = +1

Query: 37  PTGGFQDVDAQTKPCCY 87
           P G    +DA TKPC +
Sbjct: 287 PDGSKVPIDANTKPCTW 303


>AY336528-1|AAQ02339.1|  712|Apis mellifera transferrin protein.
          Length = 712

 Score = 22.6 bits (46), Expect = 2.8
 Identities = 8/17 (47%), Positives = 10/17 (58%)
 Frame = +1

Query: 37  PTGGFQDVDAQTKPCCY 87
           P G    +DA TKPC +
Sbjct: 287 PDGSKVPIDANTKPCTW 303


>AY217097-1|AAO39761.1|  712|Apis mellifera transferrin protein.
          Length = 712

 Score = 22.6 bits (46), Expect = 2.8
 Identities = 8/17 (47%), Positives = 10/17 (58%)
 Frame = +1

Query: 37  PTGGFQDVDAQTKPCCY 87
           P G    +DA TKPC +
Sbjct: 287 PDGSKVPIDANTKPCTW 303


>DQ667183-1|ABG75735.1|  463|Apis mellifera GABA-gated ion channel
           protein.
          Length = 463

 Score = 21.8 bits (44), Expect = 4.8
 Identities = 11/36 (30%), Positives = 16/36 (44%)
 Frame = +2

Query: 368 PVGRPDAPARSAEDRSAYRRTPAAPGVAPHDKKADV 475
           P  R   P+R    R   RRTP    V+  D+ + +
Sbjct: 394 PPPRQTPPSRKESGRRRRRRTPRYNSVSKIDRASRI 429


>AY569717-1|AAS86670.1|  397|Apis mellifera complementary sex
           determiner protein.
          Length = 397

 Score = 21.8 bits (44), Expect = 4.8
 Identities = 9/29 (31%), Positives = 14/29 (48%)
 Frame = -3

Query: 127 FGHHDSLFKEVLINSNTVLFGHQHLESRL 41
           + HHD  FK++    N +    +  E RL
Sbjct: 8   YSHHDEKFKQLRNEDNKIDLRSRTKEERL 36


>AY569712-1|AAS86665.1|  408|Apis mellifera complementary sex
           determiner protein.
          Length = 408

 Score = 21.8 bits (44), Expect = 4.8
 Identities = 9/29 (31%), Positives = 14/29 (48%)
 Frame = -3

Query: 127 FGHHDSLFKEVLINSNTVLFGHQHLESRL 41
           + HHD  FK++    N +    +  E RL
Sbjct: 8   YSHHDEKFKQLRNEDNKIDLRSRTKEERL 36


>AY569704-1|AAS86657.1|  426|Apis mellifera complementary sex
           determiner protein.
          Length = 426

 Score = 21.8 bits (44), Expect = 4.8
 Identities = 9/29 (31%), Positives = 14/29 (48%)
 Frame = -3

Query: 127 FGHHDSLFKEVLINSNTVLFGHQHLESRL 41
           + HHD  FK++    N +    +  E RL
Sbjct: 8   YSHHDEKFKQLRNEDNKIDLRSRTKEERL 36


>AY569703-1|AAS86656.1|  396|Apis mellifera complementary sex
           determiner protein.
          Length = 396

 Score = 21.8 bits (44), Expect = 4.8
 Identities = 9/29 (31%), Positives = 14/29 (48%)
 Frame = -3

Query: 127 FGHHDSLFKEVLINSNTVLFGHQHLESRL 41
           + HHD  FK++    N +    +  E RL
Sbjct: 8   YSHHDEKFKQLRNEDNKIDLRSRTKEERL 36


>AY569701-1|AAS86654.1|  407|Apis mellifera complementary sex
           determiner protein.
          Length = 407

 Score = 21.8 bits (44), Expect = 4.8
 Identities = 9/29 (31%), Positives = 14/29 (48%)
 Frame = -3

Query: 127 FGHHDSLFKEVLINSNTVLFGHQHLESRL 41
           + HHD  FK++    N +    +  E RL
Sbjct: 8   YSHHDEKFKQLRNEDNKIDLRSRTKEERL 36


>AY569700-1|AAS86653.1|  407|Apis mellifera complementary sex
           determiner protein.
          Length = 407

 Score = 21.8 bits (44), Expect = 4.8
 Identities = 9/29 (31%), Positives = 14/29 (48%)
 Frame = -3

Query: 127 FGHHDSLFKEVLINSNTVLFGHQHLESRL 41
           + HHD  FK++    N +    +  E RL
Sbjct: 8   YSHHDEKFKQLRNEDNKIDLRSRTKEERL 36


>AY569699-1|AAS86652.1|  396|Apis mellifera complementary sex
           determiner protein.
          Length = 396

 Score = 21.8 bits (44), Expect = 4.8
 Identities = 9/29 (31%), Positives = 14/29 (48%)
 Frame = -3

Query: 127 FGHHDSLFKEVLINSNTVLFGHQHLESRL 41
           + HHD  FK++    N +    +  E RL
Sbjct: 8   YSHHDEKFKQLRNEDNKIDLRSRTKEERL 36


>AY352276-1|AAQ67417.1|  385|Apis mellifera complementary sex
           determiner protein.
          Length = 385

 Score = 21.8 bits (44), Expect = 4.8
 Identities = 9/29 (31%), Positives = 14/29 (48%)
 Frame = -3

Query: 127 FGHHDSLFKEVLINSNTVLFGHQHLESRL 41
           + HHD  FK++    N +    +  E RL
Sbjct: 8   YSHHDEKFKQLRNEDNEIDLRSRTKEERL 36


>AY350617-1|AAQ57659.1|  428|Apis mellifera complementary sex
           determiner protein.
          Length = 428

 Score = 21.8 bits (44), Expect = 4.8
 Identities = 9/29 (31%), Positives = 14/29 (48%)
 Frame = -3

Query: 127 FGHHDSLFKEVLINSNTVLFGHQHLESRL 41
           + HHD  FK++    N +    +  E RL
Sbjct: 8   YSHHDEKFKQLRNEDNKIDLRSRTKEERL 36


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 145,609
Number of Sequences: 438
Number of extensions: 2784
Number of successful extensions: 17
Number of sequences better than 10.0: 15
Number of HSP's better than 10.0 without gapping: 17
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 17
length of database: 146,343
effective HSP length: 54
effective length of database: 122,691
effective search space used: 16072521
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -