SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B05
         (653 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ325109-1|ABD14123.1|  177|Apis mellifera complementary sex det...    24   1.5  
DQ325108-1|ABD14122.1|  177|Apis mellifera complementary sex det...    24   1.5  
DQ325107-1|ABD14121.1|  176|Apis mellifera complementary sex det...    24   1.5  
DQ325106-1|ABD14120.1|  177|Apis mellifera complementary sex det...    24   1.5  
AY350615-1|AAQ57657.1|  410|Apis mellifera complementary sex det...    24   1.5  
AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr...    23   1.9  
AF023619-1|AAC39040.1|  355|Apis mellifera arginine kinase protein.    22   6.0  
DQ869051-1|ABJ09598.1|  581|Apis mellifera pyrokinin-like recept...    21   7.9  
AY739659-1|AAU85298.1|  288|Apis mellifera hyperpolarization-act...    21   7.9  
AY739658-1|AAU85297.1|  664|Apis mellifera hyperpolarization-act...    21   7.9  
AY280848-1|AAQ16312.1|  632|Apis mellifera hyperpolarization-act...    21   7.9  
AF469010-1|AAL93136.1|  678|Apis mellifera cGMP-dependent protei...    21   7.9  

>DQ325109-1|ABD14123.1|  177|Apis mellifera complementary sex
           determiner protein.
          Length = 177

 Score = 23.8 bits (49), Expect = 1.5
 Identities = 16/53 (30%), Positives = 23/53 (43%), Gaps = 2/53 (3%)
 Frame = +2

Query: 242 KEKYAKYLPHSAGRYAHK--RFRKAQCPIVERLTNSLMMHGRNNGKKLMAVRI 394
           +  Y KY   S  R   +  R R  +  I+  L+N  + +  NN KKL    I
Sbjct: 53  ENSYRKYRETSKERSRDRKERERSKEPKIISSLSNKTIHNNNNNYKKLQYYNI 105


>DQ325108-1|ABD14122.1|  177|Apis mellifera complementary sex
           determiner protein.
          Length = 177

 Score = 23.8 bits (49), Expect = 1.5
 Identities = 16/53 (30%), Positives = 23/53 (43%), Gaps = 2/53 (3%)
 Frame = +2

Query: 242 KEKYAKYLPHSAGRYAHK--RFRKAQCPIVERLTNSLMMHGRNNGKKLMAVRI 394
           +  Y KY   S  R   +  R R  +  I+  L+N  + +  NN KKL    I
Sbjct: 53  ENSYRKYRETSKERSRDRKERERSKEPKIISSLSNKTIHNNNNNYKKLQYYNI 105


>DQ325107-1|ABD14121.1|  176|Apis mellifera complementary sex
           determiner protein.
          Length = 176

 Score = 23.8 bits (49), Expect = 1.5
 Identities = 16/53 (30%), Positives = 23/53 (43%), Gaps = 2/53 (3%)
 Frame = +2

Query: 242 KEKYAKYLPHSAGRYAHK--RFRKAQCPIVERLTNSLMMHGRNNGKKLMAVRI 394
           +  Y KY   S  R   +  R R  +  I+  L+N  + +  NN KKL    I
Sbjct: 53  ENSYRKYRETSKERSRDRKERERSKEPKIISSLSNKTIHNNNNNYKKLQYYNI 105


>DQ325106-1|ABD14120.1|  177|Apis mellifera complementary sex
           determiner protein.
          Length = 177

 Score = 23.8 bits (49), Expect = 1.5
 Identities = 16/53 (30%), Positives = 23/53 (43%), Gaps = 2/53 (3%)
 Frame = +2

Query: 242 KEKYAKYLPHSAGRYAHK--RFRKAQCPIVERLTNSLMMHGRNNGKKLMAVRI 394
           +  Y KY   S  R   +  R R  +  I+  L+N  + +  NN KKL    I
Sbjct: 53  ENSYRKYRETSKERSRDRKERERSKEPKIISSLSNKTIHNNNNNYKKLQYYNI 105


>AY350615-1|AAQ57657.1|  410|Apis mellifera complementary sex
           determiner protein.
          Length = 410

 Score = 23.8 bits (49), Expect = 1.5
 Identities = 16/53 (30%), Positives = 23/53 (43%), Gaps = 2/53 (3%)
 Frame = +2

Query: 242 KEKYAKYLPHSAGRYAHK--RFRKAQCPIVERLTNSLMMHGRNNGKKLMAVRI 394
           +  Y KY   S  R   +  R R  +  I+  L+N  + +  NN KKL    I
Sbjct: 286 ENSYRKYRETSKERSRDRKERERSKEPKIISSLSNKTIHNNNNNYKKLQYYNI 338


>AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor
           protein.
          Length = 1370

 Score = 23.4 bits (48), Expect = 1.9
 Identities = 9/28 (32%), Positives = 10/28 (35%)
 Frame = -2

Query: 640 CNTLCDCFNISECSLTCTCAQKPDCLVD 557
           C  LC C +   C    TC     C  D
Sbjct: 743 CFALCHCCDFDACDCEMTCPAGCKCYND 770


>AF023619-1|AAC39040.1|  355|Apis mellifera arginine kinase protein.
          Length = 355

 Score = 21.8 bits (44), Expect = 6.0
 Identities = 11/32 (34%), Positives = 16/32 (50%)
 Frame = -1

Query: 221 ETYQRLAHRSNSICRKA*FQECRRLVVKTWFP 126
           + Y+RL H  N I ++  F    RL   T+ P
Sbjct: 240 QVYRRLVHAVNEIEKRLLFSHNDRLGFLTFCP 271


>DQ869051-1|ABJ09598.1|  581|Apis mellifera pyrokinin-like receptor
           2 protein.
          Length = 581

 Score = 21.4 bits (43), Expect = 7.9
 Identities = 8/26 (30%), Positives = 16/26 (61%)
 Frame = +2

Query: 392 IVKHAFEIIHLLTGENPLQVLVTAII 469
           +++HAFEI  +L    P+ +++   I
Sbjct: 217 LIEHAFEISTMLFFVLPMTIIIVLYI 242


>AY739659-1|AAU85298.1|  288|Apis mellifera
           hyperpolarization-activated ion channelvariant T
           protein.
          Length = 288

 Score = 21.4 bits (43), Expect = 7.9
 Identities = 5/19 (26%), Positives = 12/19 (63%)
 Frame = -3

Query: 360 RPCIIREFVRRSTIGHWAL 304
           +  +++E +R+   GHW +
Sbjct: 63  KKALMKERIRQKAAGHWVI 81


>AY739658-1|AAU85297.1|  664|Apis mellifera
           hyperpolarization-activated ion channelvariant L
           protein.
          Length = 664

 Score = 21.4 bits (43), Expect = 7.9
 Identities = 5/19 (26%), Positives = 12/19 (63%)
 Frame = -3

Query: 360 RPCIIREFVRRSTIGHWAL 304
           +  +++E +R+   GHW +
Sbjct: 63  KKALMKERIRQKAAGHWVI 81


>AY280848-1|AAQ16312.1|  632|Apis mellifera
           hyperpolarization-activated ion channel protein.
          Length = 632

 Score = 21.4 bits (43), Expect = 7.9
 Identities = 5/19 (26%), Positives = 12/19 (63%)
 Frame = -3

Query: 360 RPCIIREFVRRSTIGHWAL 304
           +  +++E +R+   GHW +
Sbjct: 63  KKALMKERIRQKAAGHWVI 81


>AF469010-1|AAL93136.1|  678|Apis mellifera cGMP-dependent protein
           kinase foraging protein.
          Length = 678

 Score = 21.4 bits (43), Expect = 7.9
 Identities = 12/24 (50%), Positives = 13/24 (54%)
 Frame = -3

Query: 342 EFVRRSTIGHWALRKRLCAYLPAE 271
           EF R  T    AL K+LC   PAE
Sbjct: 585 EFPRSITRNATALIKKLCRDNPAE 608


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 180,512
Number of Sequences: 438
Number of extensions: 3679
Number of successful extensions: 15
Number of sequences better than 10.0: 12
Number of HSP's better than 10.0 without gapping: 15
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 15
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 19804986
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -