SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B02
         (347 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ667192-1|ABG75744.1|  489|Apis mellifera pH-sensitive chloride...    23   1.4  
DQ667191-1|ABG75743.1|  475|Apis mellifera pH-sensitive chloride...    23   1.4  
DQ667190-1|ABG75742.1|  509|Apis mellifera pH-sensitive chloride...    23   1.4  
DQ667189-1|ABG75741.1|  458|Apis mellifera pH-sensitive chloride...    23   1.4  
AB208106-1|BAE72138.1|  111|Apis mellifera Broad complex zinc fi...    21   5.5  
DQ201783-1|ABB05503.1|  381|Apis mellifera capa receptor-like GP...    20   9.6  
AB253416-1|BAE86927.1|  580|Apis mellifera alpha-glucosidase pro...    20   9.6  

>DQ667192-1|ABG75744.1|  489|Apis mellifera pH-sensitive chloride
           channel variant 4 protein.
          Length = 489

 Score = 22.6 bits (46), Expect = 1.4
 Identities = 7/15 (46%), Positives = 12/15 (80%)
 Frame = +1

Query: 151 LLQQAWLNPQVRFEH 195
           LLQQ W +P++R+ +
Sbjct: 112 LLQQQWYDPRLRYSN 126


>DQ667191-1|ABG75743.1|  475|Apis mellifera pH-sensitive chloride
           channel variant 3 protein.
          Length = 475

 Score = 22.6 bits (46), Expect = 1.4
 Identities = 7/15 (46%), Positives = 12/15 (80%)
 Frame = +1

Query: 151 LLQQAWLNPQVRFEH 195
           LLQQ W +P++R+ +
Sbjct: 112 LLQQQWYDPRLRYSN 126


>DQ667190-1|ABG75742.1|  509|Apis mellifera pH-sensitive chloride
           channel variant 1 protein.
          Length = 509

 Score = 22.6 bits (46), Expect = 1.4
 Identities = 7/15 (46%), Positives = 12/15 (80%)
 Frame = +1

Query: 151 LLQQAWLNPQVRFEH 195
           LLQQ W +P++R+ +
Sbjct: 163 LLQQQWYDPRLRYSN 177


>DQ667189-1|ABG75741.1|  458|Apis mellifera pH-sensitive chloride
           channel protein.
          Length = 458

 Score = 22.6 bits (46), Expect = 1.4
 Identities = 7/15 (46%), Positives = 12/15 (80%)
 Frame = +1

Query: 151 LLQQAWLNPQVRFEH 195
           LLQQ W +P++R+ +
Sbjct: 112 LLQQQWYDPRLRYSN 126


>AB208106-1|BAE72138.1|  111|Apis mellifera Broad complex zinc
           finger domain-Z1 isoform protein.
          Length = 111

 Score = 20.6 bits (41), Expect = 5.5
 Identities = 15/56 (26%), Positives = 23/56 (41%)
 Frame = -3

Query: 189 KPYLRIKPCLLEQDRHXPRSLSVSARVRIPNICVAHFKKLNCCFANEQQN*RQHXK 22
           +P  +I   L    RH     +  ++  I NIC   +  LN    ++    RQH K
Sbjct: 6   EPCNKILTSLTRLRRHIQNVHTRPSKEPICNICKRVYSSLNSLRNHKSIYHRQHSK 61


>DQ201783-1|ABB05503.1|  381|Apis mellifera capa receptor-like GPCR
           protein.
          Length = 381

 Score = 19.8 bits (39), Expect = 9.6
 Identities = 9/27 (33%), Positives = 13/27 (48%)
 Frame = +2

Query: 83  WATQIFGILTLADTDKDLGSCRSCSNR 163
           W T+   I   + +DK+  S   CS R
Sbjct: 355 WVTRESQICNNSSSDKERNSSFKCSMR 381


>AB253416-1|BAE86927.1|  580|Apis mellifera alpha-glucosidase
           protein.
          Length = 580

 Score = 19.8 bits (39), Expect = 9.6
 Identities = 8/20 (40%), Positives = 11/20 (55%)
 Frame = +2

Query: 188 LNICRQCFREYAHDIGFKKL 247
           LN+  Q    Y+H + FK L
Sbjct: 453 LNLAAQKREYYSHYVAFKSL 472


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 72,593
Number of Sequences: 438
Number of extensions: 1198
Number of successful extensions: 7
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 146,343
effective HSP length: 51
effective length of database: 124,005
effective search space used:  7936320
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 39 (20.8 bits)

- SilkBase 1999-2022 -