SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A24
         (653 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ026032-1|AAY87891.1|  566|Apis mellifera nicotinic acetylcholi...    23   3.4  
DQ026033-1|AAY87892.1|  569|Apis mellifera nicotinic acetylcholi...    22   4.5  
S76957-1|AAB33932.1|  169|Apis mellifera olfactory receptor prot...    22   6.0  
S76956-1|AAB33931.1|  168|Apis mellifera olfactory receptor prot...    22   6.0  

>DQ026032-1|AAY87891.1|  566|Apis mellifera nicotinic acetylcholine
           receptor alpha3subunit protein.
          Length = 566

 Score = 22.6 bits (46), Expect = 3.4
 Identities = 10/33 (30%), Positives = 16/33 (48%)
 Frame = +2

Query: 188 YKSGAKISAEHWWSQEATSLSPWXQWPFVKFVV 286
           YKS  +I  E++   E T +  +  W +  F V
Sbjct: 145 YKSSCEIDVEYFPFDEQTCVMKFGSWTYDGFQV 177


>DQ026033-1|AAY87892.1|  569|Apis mellifera nicotinic acetylcholine
           receptor alpha4subunit protein.
          Length = 569

 Score = 22.2 bits (45), Expect = 4.5
 Identities = 10/33 (30%), Positives = 16/33 (48%)
 Frame = +2

Query: 188 YKSGAKISAEHWWSQEATSLSPWXQWPFVKFVV 286
           YKS  +I  E++   E T +  +  W +  F V
Sbjct: 149 YKSSCEIDVEYFPFDEQTCVLKFGSWTYDGFKV 181


>S76957-1|AAB33932.1|  169|Apis mellifera olfactory receptor
           protein.
          Length = 169

 Score = 21.8 bits (44), Expect = 6.0
 Identities = 8/23 (34%), Positives = 13/23 (56%)
 Frame = +1

Query: 451 LVCYSRQTCDHHAEGYSTCSTNP 519
           L+   R + D     +STCS++P
Sbjct: 102 LMAILRMSADGGCRNFSTCSSHP 124


>S76956-1|AAB33931.1|  168|Apis mellifera olfactory receptor
           protein.
          Length = 168

 Score = 21.8 bits (44), Expect = 6.0
 Identities = 8/23 (34%), Positives = 13/23 (56%)
 Frame = +1

Query: 451 LVCYSRQTCDHHAEGYSTCSTNP 519
           L+   R + D     +STCS++P
Sbjct: 101 LMAILRMSADGGCRNFSTCSSHP 123


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 149,992
Number of Sequences: 438
Number of extensions: 2751
Number of successful extensions: 21
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 21
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 21
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 19804986
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -