SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A10
         (653 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase...    22   6.0  
DQ468657-1|ABE02558.1|  322|Apis mellifera 1,4,5-trisphosphate r...    21   7.9  
AB006152-1|BAA24504.1|  178|Apis mellifera inositol 1,4,5-tripho...    21   7.9  

>AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase
           protein.
          Length = 1143

 Score = 21.8 bits (44), Expect = 6.0
 Identities = 9/22 (40%), Positives = 13/22 (59%)
 Frame = +1

Query: 271 KTNFGGGKSTGFALIYDTLDLA 336
           KTN  G  S+G  L+ +  D+A
Sbjct: 724 KTNLSGDSSSGTTLLLELDDIA 745


>DQ468657-1|ABE02558.1|  322|Apis mellifera 1,4,5-trisphosphate
           receptor protein.
          Length = 322

 Score = 21.4 bits (43), Expect = 7.9
 Identities = 10/35 (28%), Positives = 21/35 (60%)
 Frame = -1

Query: 134 LVMNLRVRIVAVPSLILNYFQ*FGVYTHVSLLKQE 30
           LVM+ +++I+ +   IL+    + +   +S+ KQE
Sbjct: 43  LVMDTKLKIIEILQFILDVRLDYRISCLLSIFKQE 77


>AB006152-1|BAA24504.1|  178|Apis mellifera inositol
           1,4,5-triphosphate recepter protein.
          Length = 178

 Score = 21.4 bits (43), Expect = 7.9
 Identities = 10/35 (28%), Positives = 21/35 (60%)
 Frame = -1

Query: 134 LVMNLRVRIVAVPSLILNYFQ*FGVYTHVSLLKQE 30
           LVM+ +++I+ +   IL+    + +   +S+ KQE
Sbjct: 11  LVMDTKLKIIEILQFILDVRLDYRISCLLSIFKQE 45


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 183,297
Number of Sequences: 438
Number of extensions: 3992
Number of successful extensions: 7
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 19804986
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -