SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A06
         (414 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr...    23   1.8  
AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso...    21   7.3  
AB167961-1|BAD51404.1|  554|Apis mellifera E74 protein.                21   7.3  

>AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor
            protein.
          Length = 1370

 Score = 22.6 bits (46), Expect = 1.8
 Identities = 17/70 (24%), Positives = 30/70 (42%), Gaps = 6/70 (8%)
 Frame = +2

Query: 35   DVHIKCRTTP------VNSLTCTARGNARPATASSTLRTMLQXQLVIADVDPATGRAADT 196
            D+ I+ +++P      +N+ T    G+    T  STLR   + + +  D  PAT      
Sbjct: 1209 DISIESKSSPLVYKRNINTYTLDGVGSVEK-TGVSTLRGQERQRSLFKDSSPATALMLQH 1267

Query: 197  SKMYVVCGAI 226
            +     CG +
Sbjct: 1268 APPAYSCGTV 1277


>AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor
            protein.
          Length = 1770

 Score = 20.6 bits (41), Expect = 7.3
 Identities = 9/23 (39%), Positives = 14/23 (60%)
 Frame = +2

Query: 179  GRAADTSKMYVVCGAIRRMGESD 247
            GR  +++K YVV   +   GES+
Sbjct: 1182 GRGIESAKSYVVDVRVHVPGESE 1204


>AB167961-1|BAD51404.1|  554|Apis mellifera E74 protein.
          Length = 554

 Score = 20.6 bits (41), Expect = 7.3
 Identities = 7/15 (46%), Positives = 8/15 (53%)
 Frame = -2

Query: 251 NHQTLPSFG*PHRQH 207
           NH   P+ G PH  H
Sbjct: 340 NHTMGPTMGPPHHHH 354


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 93,732
Number of Sequences: 438
Number of extensions: 1865
Number of successful extensions: 3
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 146,343
effective HSP length: 52
effective length of database: 123,567
effective search space used: 10503195
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)

- SilkBase 1999-2022 -