BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_G05 (649 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 23 1.9 DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholi... 23 2.5 DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholi... 23 2.5 DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly pro... 23 3.4 DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 22 5.9 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 22 5.9 D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. 21 7.8 AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly pro... 21 7.8 AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly pro... 21 7.8 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 21 7.8 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 23.4 bits (48), Expect = 1.9 Identities = 14/48 (29%), Positives = 22/48 (45%) Frame = +3 Query: 471 NQARQEDAAANMLLFTTLIKLNCSPDLRFFLCSVYAPVCTILDSAIPP 614 + A++E A L + L C L FF C++ +CT L + P Sbjct: 609 SSAKKERKATKTLAIVLGVFLICW--LPFFTCNIMDAICTKLTADCQP 654 >DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 23.0 bits (47), Expect = 2.5 Identities = 9/32 (28%), Positives = 17/32 (53%) Frame = +2 Query: 110 YYVLIKVCHNMLISNKRHFKRDKYLHVTWVKI 205 + V V +L+ N H D+Y+ +W+K+ Sbjct: 334 FMVASSVVLTVLVLNFHHRTPDRYVMPSWIKM 365 >DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 23.0 bits (47), Expect = 2.5 Identities = 9/32 (28%), Positives = 17/32 (53%) Frame = +2 Query: 110 YYVLIKVCHNMLISNKRHFKRDKYLHVTWVKI 205 + V V +L+ N H D+Y+ +W+K+ Sbjct: 334 FMVASSVVLTVLVLNFHHRTPDRYVMPSWIKM 365 >DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly protein 9 protein. Length = 423 Score = 22.6 bits (46), Expect = 3.4 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -2 Query: 468 KYSEKWFDYNAISDK 424 KY K+FDYN SD+ Sbjct: 35 KYQWKYFDYNFGSDE 49 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 21.8 bits (44), Expect = 5.9 Identities = 8/18 (44%), Positives = 14/18 (77%) Frame = +3 Query: 18 SSYRNYFVNFSLISNKKT 71 SS+R + V+ S++ +KKT Sbjct: 397 SSFREFAVSTSILGDKKT 414 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.8 bits (44), Expect = 5.9 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -1 Query: 55 ISEKFTK*LRYEENM 11 ISEKF K +R E+N+ Sbjct: 611 ISEKFRKLIRIEDNV 625 >D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. Length = 432 Score = 21.4 bits (43), Expect = 7.8 Identities = 8/24 (33%), Positives = 16/24 (66%) Frame = +3 Query: 315 IFSLLCLFALTKGSRXIVYQGDSL 386 +F L+CL + +G+ + +G+SL Sbjct: 4 LFMLVCLGIVCQGTTGNILRGESL 27 >AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 21.4 bits (43), Expect = 7.8 Identities = 8/24 (33%), Positives = 16/24 (66%) Frame = +3 Query: 315 IFSLLCLFALTKGSRXIVYQGDSL 386 +F L+CL + +G+ + +G+SL Sbjct: 4 LFMLVCLGIVCQGTTGNILRGESL 27 >AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 21.4 bits (43), Expect = 7.8 Identities = 8/24 (33%), Positives = 16/24 (66%) Frame = +3 Query: 315 IFSLLCLFALTKGSRXIVYQGDSL 386 +F L+CL + +G+ + +G+SL Sbjct: 4 LFMLVCLGIVCQGTTGNILRGESL 27 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 21.4 bits (43), Expect = 7.8 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +3 Query: 516 TTLIKLNCSPDLRFFLCSVYAPVCTILD 599 T LIKLN P C +YA C L+ Sbjct: 46 TPLIKLNNIPKSYGIKCEIYAK-CEFLN 72 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 169,039 Number of Sequences: 438 Number of extensions: 3145 Number of successful extensions: 11 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19560480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -