BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0045 (538 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 23 2.0 DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex det... 23 2.6 DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex det... 23 2.6 DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex det... 23 2.6 DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex det... 21 6.0 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 21 8.0 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 23.0 bits (47), Expect = 2.0 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +2 Query: 32 HTQEFRLTTN*SRQKKAKED 91 H Q + +T ++QKK KED Sbjct: 7 HYQHYHITPVFTKQKKVKED 26 >DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 22.6 bits (46), Expect = 2.6 Identities = 9/36 (25%), Positives = 19/36 (52%) Frame = +3 Query: 75 RRPRKIFVEKLKPVFISKHYRFEFLQHKFNLSCKYL 182 R P+ I K + + +Y++ + + +N +CK L Sbjct: 77 REPKIISSLSNKTIHNNNNYKYNYNNNNYNNNCKKL 112 >DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 22.6 bits (46), Expect = 2.6 Identities = 9/36 (25%), Positives = 19/36 (52%) Frame = +3 Query: 75 RRPRKIFVEKLKPVFISKHYRFEFLQHKFNLSCKYL 182 R P+ I K + + +Y++ + + +N +CK L Sbjct: 77 REPKIISSLSNKTIHNNNNYKYNYNNNNYNNNCKKL 112 >DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 22.6 bits (46), Expect = 2.6 Identities = 9/36 (25%), Positives = 19/36 (52%) Frame = +3 Query: 75 RRPRKIFVEKLKPVFISKHYRFEFLQHKFNLSCKYL 182 R P+ I K + + +Y++ + + +N +CK L Sbjct: 77 REPKIISSLSNKTIHNNNNYKYNYNNNNYNNNCKKL 112 >DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex determiner protein. Length = 186 Score = 21.4 bits (43), Expect = 6.0 Identities = 8/36 (22%), Positives = 19/36 (52%) Frame = +3 Query: 75 RRPRKIFVEKLKPVFISKHYRFEFLQHKFNLSCKYL 182 R P+ I + + + +Y++ + + +N +CK L Sbjct: 77 REPKIISSLSNRTIHNNNNYKYNYNNNNYNNNCKKL 112 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 21.0 bits (42), Expect = 8.0 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = +1 Query: 274 CLAKLRDLILHNSLTPFHS*CHLS*FSACFIFR 372 CL D I+++SL+ F+ C + F IF+ Sbjct: 336 CLFYNTDFIIYSSLSSFYIPCIIMVFLYYNIFK 368 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 144,475 Number of Sequences: 438 Number of extensions: 3078 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15213684 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -