SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120043.Seq
         (810 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB244761-1|BAE66603.1|  504|Apis mellifera cystathionine beta-sy...    24   1.4  
AF469010-1|AAL93136.1|  678|Apis mellifera cGMP-dependent protei...    24   1.9  
EF625896-1|ABR45903.1|  683|Apis mellifera hexamerin protein.          23   2.5  
AY601637-1|AAT11850.1|  683|Apis mellifera hexamerin 70b protein.      23   2.5  
DQ325102-1|ABD14116.1|  183|Apis mellifera complementary sex det...    23   3.3  
DQ325101-1|ABD14115.1|  182|Apis mellifera complementary sex det...    23   3.3  
DQ325100-1|ABD14114.1|  183|Apis mellifera complementary sex det...    23   3.3  
DQ325099-1|ABD14113.1|  183|Apis mellifera complementary sex det...    23   3.3  
DQ325098-1|ABD14112.1|  183|Apis mellifera complementary sex det...    23   3.3  
DQ325097-1|ABD14111.1|  183|Apis mellifera complementary sex det...    23   3.3  
DQ325096-1|ABD14110.1|  183|Apis mellifera complementary sex det...    23   3.3  
DQ325095-1|ABD14109.1|  183|Apis mellifera complementary sex det...    23   3.3  
Z26318-1|CAA81227.1|  544|Apis mellifera royal jelly protein RJP...    22   5.8  

>AB244761-1|BAE66603.1|  504|Apis mellifera cystathionine
           beta-synthase protein.
          Length = 504

 Score = 24.2 bits (50), Expect = 1.4
 Identities = 7/19 (36%), Positives = 12/19 (63%)
 Frame = +2

Query: 389 VCSVHLWRWWWP*RIVNMN 445
           VC   + +WWW  +I N++
Sbjct: 358 VCQNEMNKWWWNMKISNLS 376


>AF469010-1|AAL93136.1|  678|Apis mellifera cGMP-dependent protein
           kinase foraging protein.
          Length = 678

 Score = 23.8 bits (49), Expect = 1.9
 Identities = 12/42 (28%), Positives = 19/42 (45%)
 Frame = -3

Query: 127 DLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           +L+  L+ KG             + EA + LH  N I+ D+K
Sbjct: 452 ELWTVLRDKGHFDDGTTRFYTACVVEAFDYLHSRNIIYRDLK 493


>EF625896-1|ABR45903.1|  683|Apis mellifera hexamerin protein.
          Length = 683

 Score = 23.4 bits (48), Expect = 2.5
 Identities = 10/21 (47%), Positives = 14/21 (66%)
 Frame = +2

Query: 515 YCGSANYQRQHLRQHSVAEQR 577
           Y  +ANY   +L +H+V EQR
Sbjct: 198 YLLAANYTGWYLTKHNVPEQR 218


>AY601637-1|AAT11850.1|  683|Apis mellifera hexamerin 70b protein.
          Length = 683

 Score = 23.4 bits (48), Expect = 2.5
 Identities = 10/21 (47%), Positives = 14/21 (66%)
 Frame = +2

Query: 515 YCGSANYQRQHLRQHSVAEQR 577
           Y  +ANY   +L +H+V EQR
Sbjct: 198 YLLAANYTGWYLTKHNVPEQR 218


>DQ325102-1|ABD14116.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 23.0 bits (47), Expect = 3.3
 Identities = 8/29 (27%), Positives = 16/29 (55%)
 Frame = -3

Query: 253 NFNVDEIKVHQLMNDHPNFIKIYFNHGFI 167
           N+N      +   N++ N+ K+Y+N  +I
Sbjct: 88  NYNYSNYNNYNNNNNYNNYKKLYYNINYI 116


>DQ325101-1|ABD14115.1|  182|Apis mellifera complementary sex
           determiner protein.
          Length = 182

 Score = 23.0 bits (47), Expect = 3.3
 Identities = 8/29 (27%), Positives = 16/29 (55%)
 Frame = -3

Query: 253 NFNVDEIKVHQLMNDHPNFIKIYFNHGFI 167
           N+N      +   N++ N+ K+Y+N  +I
Sbjct: 88  NYNYSNYNNYNNNNNYNNYKKLYYNINYI 116


>DQ325100-1|ABD14114.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 23.0 bits (47), Expect = 3.3
 Identities = 8/29 (27%), Positives = 16/29 (55%)
 Frame = -3

Query: 253 NFNVDEIKVHQLMNDHPNFIKIYFNHGFI 167
           N+N      +   N++ N+ K+Y+N  +I
Sbjct: 88  NYNYSNYNNYNNNNNYNNYKKLYYNINYI 116


>DQ325099-1|ABD14113.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 23.0 bits (47), Expect = 3.3
 Identities = 8/29 (27%), Positives = 16/29 (55%)
 Frame = -3

Query: 253 NFNVDEIKVHQLMNDHPNFIKIYFNHGFI 167
           N+N      +   N++ N+ K+Y+N  +I
Sbjct: 88  NYNYSNYNNYNNNNNYNNYKKLYYNINYI 116


>DQ325098-1|ABD14112.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 23.0 bits (47), Expect = 3.3
 Identities = 8/29 (27%), Positives = 16/29 (55%)
 Frame = -3

Query: 253 NFNVDEIKVHQLMNDHPNFIKIYFNHGFI 167
           N+N      +   N++ N+ K+Y+N  +I
Sbjct: 88  NYNYSNYNNYNNNNNYNNYKKLYYNINYI 116


>DQ325097-1|ABD14111.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 23.0 bits (47), Expect = 3.3
 Identities = 8/29 (27%), Positives = 16/29 (55%)
 Frame = -3

Query: 253 NFNVDEIKVHQLMNDHPNFIKIYFNHGFI 167
           N+N      +   N++ N+ K+Y+N  +I
Sbjct: 88  NYNYSNYNNYNNNNNYNNYKKLYYNINYI 116


>DQ325096-1|ABD14110.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 23.0 bits (47), Expect = 3.3
 Identities = 8/29 (27%), Positives = 16/29 (55%)
 Frame = -3

Query: 253 NFNVDEIKVHQLMNDHPNFIKIYFNHGFI 167
           N+N      +   N++ N+ K+Y+N  +I
Sbjct: 88  NYNYSNYNNYNNNNNYNNYKKLYYNINYI 116


>DQ325095-1|ABD14109.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 23.0 bits (47), Expect = 3.3
 Identities = 8/29 (27%), Positives = 16/29 (55%)
 Frame = -3

Query: 253 NFNVDEIKVHQLMNDHPNFIKIYFNHGFI 167
           N+N      +   N++ N+ K+Y+N  +I
Sbjct: 88  NYNYSNYNNYNNNNNYNNYKKLYYNINYI 116


>Z26318-1|CAA81227.1|  544|Apis mellifera royal jelly protein
           RJP57-1 protein.
          Length = 544

 Score = 22.2 bits (45), Expect = 5.8
 Identities = 7/24 (29%), Positives = 15/24 (62%)
 Frame = -1

Query: 375 YENCKNVKTRYKIINGRFGKISIL 304
           YE+C  + + +KI   +F ++ +L
Sbjct: 121 YEDCSGIVSAFKIAVDKFDRLWVL 144


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 211,948
Number of Sequences: 438
Number of extensions: 4687
Number of successful extensions: 16
Number of sequences better than 10.0: 13
Number of HSP's better than 10.0 without gapping: 16
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 16
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 25731924
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -