SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120042.Seq
         (745 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ011226-1|AAY63895.1|  471|Apis mellifera Rh-like protein protein.    23   2.3  
AY921573-1|AAX62923.1|  694|Apis mellifera D2-like dopamine rece...    23   3.0  
AY569719-1|AAS86672.1|  401|Apis mellifera feminizer protein.          23   4.0  
AY569718-1|AAS86671.1|  401|Apis mellifera feminizer protein.          23   4.0  
AY569715-1|AAS86668.1|  401|Apis mellifera feminizer protein.          23   4.0  
AY569714-1|AAS86667.1|  401|Apis mellifera feminizer protein.          23   4.0  
AY569713-1|AAS86666.1|  401|Apis mellifera feminizer protein.          23   4.0  
AY569711-1|AAS86664.1|  401|Apis mellifera feminizer protein.          23   4.0  
AY569702-1|AAS86655.1|  400|Apis mellifera feminizer protein.          23   4.0  
AY350616-1|AAQ57658.1|  401|Apis mellifera complementary sex det...    23   4.0  
AB022908-1|BAA86909.1|  493|Apis mellifera amylase protein.            23   4.0  
DQ342041-1|ABC69933.1|  828|Apis mellifera STIP protein.               22   5.3  
DQ435324-1|ABD92639.1|  152|Apis mellifera OBP3 protein.               22   7.0  
AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul...    22   7.0  
AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A...    22   7.0  

>DQ011226-1|AAY63895.1|  471|Apis mellifera Rh-like protein protein.
          Length = 471

 Score = 23.4 bits (48), Expect = 2.3
 Identities = 8/17 (47%), Positives = 15/17 (88%)
 Frame = +3

Query: 450 MGVLKIIIDTVIKYIGK 500
           MG++++I+ TV KY+G+
Sbjct: 146 MGIVELIMFTVNKYVGE 162


>AY921573-1|AAX62923.1|  694|Apis mellifera D2-like dopamine
           receptor protein.
          Length = 694

 Score = 23.0 bits (47), Expect = 3.0
 Identities = 8/33 (24%), Positives = 20/33 (60%)
 Frame = +2

Query: 155 GRPSRCNAGYILDERIAK*RVHVTIIQIPITKT 253
           G+PS+ N G    + + + +  V+++ +P+ +T
Sbjct: 538 GQPSKRNGGETNKQELKRLKSTVSLLPLPLART 570


>AY569719-1|AAS86672.1|  401|Apis mellifera feminizer protein.
          Length = 401

 Score = 22.6 bits (46), Expect = 4.0
 Identities = 8/18 (44%), Positives = 11/18 (61%)
 Frame = +2

Query: 422 KRRRGWRTQHGRFKDHHR 475
           +RRR W  Q  R ++H R
Sbjct: 37  RRRREWMIQQEREREHER 54


>AY569718-1|AAS86671.1|  401|Apis mellifera feminizer protein.
          Length = 401

 Score = 22.6 bits (46), Expect = 4.0
 Identities = 8/18 (44%), Positives = 11/18 (61%)
 Frame = +2

Query: 422 KRRRGWRTQHGRFKDHHR 475
           +RRR W  Q  R ++H R
Sbjct: 37  RRRREWMIQQEREREHER 54


>AY569715-1|AAS86668.1|  401|Apis mellifera feminizer protein.
          Length = 401

 Score = 22.6 bits (46), Expect = 4.0
 Identities = 8/18 (44%), Positives = 11/18 (61%)
 Frame = +2

Query: 422 KRRRGWRTQHGRFKDHHR 475
           +RRR W  Q  R ++H R
Sbjct: 37  RRRREWMIQQEREREHER 54


>AY569714-1|AAS86667.1|  401|Apis mellifera feminizer protein.
          Length = 401

 Score = 22.6 bits (46), Expect = 4.0
 Identities = 8/18 (44%), Positives = 11/18 (61%)
 Frame = +2

Query: 422 KRRRGWRTQHGRFKDHHR 475
           +RRR W  Q  R ++H R
Sbjct: 37  RRRREWMIQQEREREHER 54


>AY569713-1|AAS86666.1|  401|Apis mellifera feminizer protein.
          Length = 401

 Score = 22.6 bits (46), Expect = 4.0
 Identities = 8/18 (44%), Positives = 11/18 (61%)
 Frame = +2

Query: 422 KRRRGWRTQHGRFKDHHR 475
           +RRR W  Q  R ++H R
Sbjct: 37  RRRREWMIQQEREREHER 54


>AY569711-1|AAS86664.1|  401|Apis mellifera feminizer protein.
          Length = 401

 Score = 22.6 bits (46), Expect = 4.0
 Identities = 8/18 (44%), Positives = 11/18 (61%)
 Frame = +2

Query: 422 KRRRGWRTQHGRFKDHHR 475
           +RRR W  Q  R ++H R
Sbjct: 37  RRRREWMIQQEREREHER 54


>AY569702-1|AAS86655.1|  400|Apis mellifera feminizer protein.
          Length = 400

 Score = 22.6 bits (46), Expect = 4.0
 Identities = 8/18 (44%), Positives = 11/18 (61%)
 Frame = +2

Query: 422 KRRRGWRTQHGRFKDHHR 475
           +RRR W  Q  R ++H R
Sbjct: 37  RRRREWMIQQEREREHER 54


>AY350616-1|AAQ57658.1|  401|Apis mellifera complementary sex
           determiner protein.
          Length = 401

 Score = 22.6 bits (46), Expect = 4.0
 Identities = 8/18 (44%), Positives = 11/18 (61%)
 Frame = +2

Query: 422 KRRRGWRTQHGRFKDHHR 475
           +RRR W  Q  R ++H R
Sbjct: 37  RRRREWMIQQEREREHER 54


>AB022908-1|BAA86909.1|  493|Apis mellifera amylase protein.
          Length = 493

 Score = 22.6 bits (46), Expect = 4.0
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = +1

Query: 223 NNYSDPDNENEC 258
           NNY+DP N   C
Sbjct: 159 NNYNDPSNVRNC 170


>DQ342041-1|ABC69933.1|  828|Apis mellifera STIP protein.
          Length = 828

 Score = 22.2 bits (45), Expect = 5.3
 Identities = 11/31 (35%), Positives = 15/31 (48%), Gaps = 4/31 (12%)
 Frame = +1

Query: 109 LDLCASVKLT----PFKPMRPPKPMQCWIHP 189
           LD+    KLT     + P+    P+  WIHP
Sbjct: 515 LDMLVLPKLTLEVEEWNPLTDTVPIHTWIHP 545


>DQ435324-1|ABD92639.1|  152|Apis mellifera OBP3 protein.
          Length = 152

 Score = 21.8 bits (44), Expect = 7.0
 Identities = 9/31 (29%), Positives = 15/31 (48%)
 Frame = -3

Query: 260 QHSFSLSGSE*LLRGRVTLQFARRGCIQHCI 168
           Q + +L   + LL         +RGCI+ C+
Sbjct: 30  QENLNLDDIDSLLEDESERMLRKRGCIEACL 60


>AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule
            AbsCAM-Ig7B protein.
          Length = 1923

 Score = 21.8 bits (44), Expect = 7.0
 Identities = 11/42 (26%), Positives = 18/42 (42%)
 Frame = +3

Query: 396  KPIRTEHFRSVDEAGEHNMGVLKIIIDTVIKYIGKLAETSTF 521
            +PI  + +RSVDE        L  ++  + KY     +   F
Sbjct: 1152 EPILADMWRSVDEMEVRKTSALTTVLTGLRKYTNYTIQVLAF 1193


>AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member
            AbsCAM-Ig7A protein.
          Length = 1919

 Score = 21.8 bits (44), Expect = 7.0
 Identities = 11/42 (26%), Positives = 18/42 (42%)
 Frame = +3

Query: 396  KPIRTEHFRSVDEAGEHNMGVLKIIIDTVIKYIGKLAETSTF 521
            +PI  + +RSVDE        L  ++  + KY     +   F
Sbjct: 1148 EPILADMWRSVDEMEVRKTSALTTVLTGLRKYTNYTIQVLAF 1189


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 183,519
Number of Sequences: 438
Number of extensions: 3897
Number of successful extensions: 17
Number of sequences better than 10.0: 15
Number of HSP's better than 10.0 without gapping: 17
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 17
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 23266665
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -