SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120041.Seq
         (827 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY268031-1|AAP23056.1|  810|Apis mellifera dorsal protein splice...    24   1.5  
AY242387-1|AAO72539.2|  693|Apis mellifera prophenoloxidase prot...    23   4.6  
DQ325089-1|ABD14103.1|  185|Apis mellifera complementary sex det...    22   6.0  
DQ325088-1|ABD14102.1|  185|Apis mellifera complementary sex det...    22   6.0  
AY569694-1|AAS86647.1|  400|Apis mellifera complementary sex det...    22   6.0  
AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.              22   8.0  
AY569703-1|AAS86656.1|  396|Apis mellifera complementary sex det...    22   8.0  
AY569701-1|AAS86654.1|  407|Apis mellifera complementary sex det...    22   8.0  
AY569700-1|AAS86653.1|  407|Apis mellifera complementary sex det...    22   8.0  
AY569699-1|AAS86652.1|  396|Apis mellifera complementary sex det...    22   8.0  
AY569697-1|AAS86650.1|  413|Apis mellifera complementary sex det...    22   8.0  
AY352277-1|AAQ67418.1|  418|Apis mellifera complementary sex det...    22   8.0  
AY352276-1|AAQ67417.1|  385|Apis mellifera complementary sex det...    22   8.0  
AY350615-1|AAQ57657.1|  410|Apis mellifera complementary sex det...    22   8.0  

>AY268031-1|AAP23056.1|  810|Apis mellifera dorsal protein splice
           variant B protein.
          Length = 810

 Score = 24.2 bits (50), Expect = 1.5
 Identities = 10/31 (32%), Positives = 16/31 (51%)
 Frame = +2

Query: 428 ICDNLKYTEVSQAARNALYTAFTQLQEHSRH 520
           +CDN  YT +  A +N +   FT L    ++
Sbjct: 576 VCDNQTYTSLQMAMKNPI--EFTDLSNERKY 604


>AY242387-1|AAO72539.2|  693|Apis mellifera prophenoloxidase
           protein.
          Length = 693

 Score = 22.6 bits (46), Expect = 4.6
 Identities = 8/24 (33%), Positives = 12/24 (50%)
 Frame = +2

Query: 551 VARRIAFFRRDQRPNASRWCWRSI 622
           V  R+A++R D   N   W W  +
Sbjct: 192 VEHRVAYWREDIGINLHHWHWHLV 215


>DQ325089-1|ABD14103.1|  185|Apis mellifera complementary sex
           determiner protein.
          Length = 185

 Score = 22.2 bits (45), Expect = 6.0
 Identities = 9/17 (52%), Positives = 12/17 (70%)
 Frame = -2

Query: 580 TSKKRNSSRDTREQNVF 530
           T++KRNS    REQN +
Sbjct: 33  TNRKRNSRSREREQNSY 49


>DQ325088-1|ABD14102.1|  185|Apis mellifera complementary sex
           determiner protein.
          Length = 185

 Score = 22.2 bits (45), Expect = 6.0
 Identities = 9/17 (52%), Positives = 12/17 (70%)
 Frame = -2

Query: 580 TSKKRNSSRDTREQNVF 530
           T++KRNS    REQN +
Sbjct: 33  TNRKRNSRSREREQNSY 49


>AY569694-1|AAS86647.1|  400|Apis mellifera complementary sex
           determiner protein.
          Length = 400

 Score = 22.2 bits (45), Expect = 6.0
 Identities = 12/52 (23%), Positives = 24/52 (46%)
 Frame = -3

Query: 654 NFAKIHCNC*IIDRQHHLDAFGRWSRRKNAIRRATHANKTCSGLWCLECSCS 499
           N  K H    +++ +   +   +++   N++R  TH  +  S  +  E SCS
Sbjct: 176 NKIKEHDTVLVVNIEKSENESKKYATSSNSLRNRTHGFQHTSSRYSRERSCS 227


>AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.
          Length = 1946

 Score = 21.8 bits (44), Expect = 8.0
 Identities = 10/24 (41%), Positives = 11/24 (45%)
 Frame = +2

Query: 8    CRGPYL*RQQYGANARGYGAATNE 79
            C    L  + YG NARG    T E
Sbjct: 1888 CDRDQLVNRNYGVNARGKDGMTTE 1911


>AY569703-1|AAS86656.1|  396|Apis mellifera complementary sex
           determiner protein.
          Length = 396

 Score = 21.8 bits (44), Expect = 8.0
 Identities = 9/30 (30%), Positives = 16/30 (53%)
 Frame = -3

Query: 588 RWSRRKNAIRRATHANKTCSGLWCLECSCS 499
           +++   N++R  TH  +  S  +  E SCS
Sbjct: 198 KYATSSNSLRNRTHGFQHTSSRYSRERSCS 227


>AY569701-1|AAS86654.1|  407|Apis mellifera complementary sex
           determiner protein.
          Length = 407

 Score = 21.8 bits (44), Expect = 8.0
 Identities = 9/30 (30%), Positives = 16/30 (53%)
 Frame = -3

Query: 588 RWSRRKNAIRRATHANKTCSGLWCLECSCS 499
           +++   N++R  TH  +  S  +  E SCS
Sbjct: 209 KYATSSNSLRNRTHGFQHTSSRYSRERSCS 238


>AY569700-1|AAS86653.1|  407|Apis mellifera complementary sex
           determiner protein.
          Length = 407

 Score = 21.8 bits (44), Expect = 8.0
 Identities = 9/30 (30%), Positives = 16/30 (53%)
 Frame = -3

Query: 588 RWSRRKNAIRRATHANKTCSGLWCLECSCS 499
           +++   N++R  TH  +  S  +  E SCS
Sbjct: 209 KYATSSNSLRNRTHGFQHTSSRYSRERSCS 238


>AY569699-1|AAS86652.1|  396|Apis mellifera complementary sex
           determiner protein.
          Length = 396

 Score = 21.8 bits (44), Expect = 8.0
 Identities = 9/30 (30%), Positives = 16/30 (53%)
 Frame = -3

Query: 588 RWSRRKNAIRRATHANKTCSGLWCLECSCS 499
           +++   N++R  TH  +  S  +  E SCS
Sbjct: 198 KYATSSNSLRNRTHGFQHTSSRYSRERSCS 227


>AY569697-1|AAS86650.1|  413|Apis mellifera complementary sex
           determiner protein.
          Length = 413

 Score = 21.8 bits (44), Expect = 8.0
 Identities = 9/30 (30%), Positives = 16/30 (53%)
 Frame = -3

Query: 588 RWSRRKNAIRRATHANKTCSGLWCLECSCS 499
           +++   N++R  TH  +  S  +  E SCS
Sbjct: 209 KYATSSNSLRNRTHGFQHTSSRYSRERSCS 238


>AY352277-1|AAQ67418.1|  418|Apis mellifera complementary sex
           determiner protein.
          Length = 418

 Score = 21.8 bits (44), Expect = 8.0
 Identities = 9/30 (30%), Positives = 16/30 (53%)
 Frame = -3

Query: 588 RWSRRKNAIRRATHANKTCSGLWCLECSCS 499
           +++   N++R  TH  +  S  +  E SCS
Sbjct: 214 KYATSSNSLRNRTHGFQHTSSRYSRERSCS 243


>AY352276-1|AAQ67417.1|  385|Apis mellifera complementary sex
           determiner protein.
          Length = 385

 Score = 21.8 bits (44), Expect = 8.0
 Identities = 9/30 (30%), Positives = 16/30 (53%)
 Frame = -3

Query: 588 RWSRRKNAIRRATHANKTCSGLWCLECSCS 499
           +++   N++R  TH  +  S  +  E SCS
Sbjct: 209 KYATSSNSLRNRTHGFQHTSSRYSRERSCS 238


>AY350615-1|AAQ57657.1|  410|Apis mellifera complementary sex
           determiner protein.
          Length = 410

 Score = 21.8 bits (44), Expect = 8.0
 Identities = 9/30 (30%), Positives = 16/30 (53%)
 Frame = -3

Query: 588 RWSRRKNAIRRATHANKTCSGLWCLECSCS 499
           +++   N++R  TH  +  S  +  E SCS
Sbjct: 209 KYATSSNSLRNRTHGFQHTSSRYSRERSCS 238


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 237,642
Number of Sequences: 438
Number of extensions: 5234
Number of successful extensions: 37
Number of sequences better than 10.0: 14
Number of HSP's better than 10.0 without gapping: 37
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 37
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 26460186
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -