SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120040.Seq
         (757 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso...    23   2.3  
Y13429-1|CAA73841.1|  402|Apis mellifera dopamine receptor, D1 p...    23   4.1  
S76957-1|AAB33932.1|  169|Apis mellifera olfactory receptor prot...    23   4.1  
S76956-1|AAB33931.1|  168|Apis mellifera olfactory receptor prot...    23   4.1  
AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ...    23   4.1  
AB086196-1|BAD06465.1|  289|Apis mellifera Period protein.             23   4.1  
AJ276511-1|CAC06383.1|  352|Apis mellifera Antennapedia protein ...    22   5.4  
EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot...    22   7.1  
Z26318-1|CAA81227.1|  544|Apis mellifera royal jelly protein RJP...    21   9.4  
DQ000307-1|AAY21180.1|  423|Apis mellifera major royal jelly pro...    21   9.4  
AY769960-1|AAV34676.1|  603|Apis mellifera soluble guanylyl cycl...    21   9.4  
AB181489-1|BAD22772.1|  603|Apis mellifera soluble guanylyl cycl...    21   9.4  

>AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor
           protein.
          Length = 1770

 Score = 23.4 bits (48), Expect = 2.3
 Identities = 13/39 (33%), Positives = 18/39 (46%)
 Frame = -1

Query: 214 LNIMRTGFVNCVFIILLMYTNSLVCSST*QSRITVWDTS 98
           LN M +  V C  + LLM TN  +      +  T  DT+
Sbjct: 691 LNTMESHEVRCTAVFLLMKTNPPLSMLQRMAEFTKLDTN 729


>Y13429-1|CAA73841.1|  402|Apis mellifera dopamine receptor, D1
           protein.
          Length = 402

 Score = 22.6 bits (46), Expect = 4.1
 Identities = 9/26 (34%), Positives = 16/26 (61%)
 Frame = -1

Query: 217 MLNIMRTGFVNCVFIILLMYTNSLVC 140
           +L+++  GF+  + I L +  N LVC
Sbjct: 22  LLSVLLVGFLFLILIFLSVAGNILVC 47


>S76957-1|AAB33932.1|  169|Apis mellifera olfactory receptor
           protein.
          Length = 169

 Score = 22.6 bits (46), Expect = 4.1
 Identities = 10/25 (40%), Positives = 15/25 (60%)
 Frame = -1

Query: 271 YSVAQMLFLRVTLRIGPEMLNIMRT 197
           YSVA    L + L +GP ++ +M T
Sbjct: 12  YSVAMSQRLCIQLVVGPYVIGLMNT 36


>S76956-1|AAB33931.1|  168|Apis mellifera olfactory receptor
           protein.
          Length = 168

 Score = 22.6 bits (46), Expect = 4.1
 Identities = 10/25 (40%), Positives = 15/25 (60%)
 Frame = -1

Query: 271 YSVAQMLFLRVTLRIGPEMLNIMRT 197
           YSVA    L + L +GP ++ +M T
Sbjct: 11  YSVAMSQRLCIQLVVGPYVIGLMNT 35


>AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein
           protein.
          Length = 1124

 Score = 22.6 bits (46), Expect = 4.1
 Identities = 10/29 (34%), Positives = 17/29 (58%)
 Frame = -3

Query: 755 TFSESLNDDGNINFCTNSSNCLPSNSTLS 669
           T +  ++D G  N C+NS +   S S++S
Sbjct: 7   TENAKVSDSGYSNTCSNSQSQRSSGSSIS 35


>AB086196-1|BAD06465.1|  289|Apis mellifera Period protein.
          Length = 289

 Score = 22.6 bits (46), Expect = 4.1
 Identities = 10/29 (34%), Positives = 17/29 (58%)
 Frame = -3

Query: 755 TFSESLNDDGNINFCTNSSNCLPSNSTLS 669
           T +  ++D G  N C+NS +   S S++S
Sbjct: 7   TENAKVSDSGYSNTCSNSQSQRSSGSSIS 35


>AJ276511-1|CAC06383.1|  352|Apis mellifera Antennapedia protein
           protein.
          Length = 352

 Score = 22.2 bits (45), Expect = 5.4
 Identities = 12/46 (26%), Positives = 19/46 (41%)
 Frame = +2

Query: 242 AQEQHLRDRIKSKVDEQFDQLEREYSDKIDGFHDNIQYFKDEHYSV 379
           AQ+QHL+   +  + +Q  Q +        G H   Q    +H  V
Sbjct: 190 AQQQHLQAHEQHMMYQQQQQSQAASQQSQPGMHPRQQQQAQQHQGV 235


>EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein
           protein.
          Length = 1010

 Score = 21.8 bits (44), Expect = 7.1
 Identities = 9/22 (40%), Positives = 14/22 (63%)
 Frame = +2

Query: 215 HFGSYTKRYAQEQHLRDRIKSK 280
           H G +   YAQ Q ++D+I S+
Sbjct: 930 HAGGWQSIYAQPQTVQDQIVSE 951


>Z26318-1|CAA81227.1|  544|Apis mellifera royal jelly protein
           RJP57-1 protein.
          Length = 544

 Score = 21.4 bits (43), Expect = 9.4
 Identities = 8/16 (50%), Positives = 11/16 (68%)
 Frame = +1

Query: 658 LAYVDSVEFDGKQFEE 705
           L YVD+ +F   Q+EE
Sbjct: 278 LYYVDTEQFSNPQYEE 293


>DQ000307-1|AAY21180.1|  423|Apis mellifera major royal jelly
           protein 9 protein.
          Length = 423

 Score = 21.4 bits (43), Expect = 9.4
 Identities = 11/36 (30%), Positives = 18/36 (50%)
 Frame = +1

Query: 634 TGLYEYDVLAYVDSVEFDGKQFEEFVQKLILPSSFN 741
           +G Y Y     +D   ++GK F   ++   +PSS N
Sbjct: 57  SGEYNYKNNVPIDVDRWNGKTFVTILRNDGVPSSLN 92


>AY769960-1|AAV34676.1|  603|Apis mellifera soluble guanylyl cyclase
           beta 1 subunit protein.
          Length = 603

 Score = 21.4 bits (43), Expect = 9.4
 Identities = 10/23 (43%), Positives = 12/23 (52%)
 Frame = -2

Query: 198 RVLSIACS*SC*CTPTLWFVRPH 130
           RV+   CS +C     L  VRPH
Sbjct: 236 RVIPQVCSGNCKLNDILLTVRPH 258


>AB181489-1|BAD22772.1|  603|Apis mellifera soluble guanylyl cyclase
           beta 1 subunit protein.
          Length = 603

 Score = 21.4 bits (43), Expect = 9.4
 Identities = 10/23 (43%), Positives = 12/23 (52%)
 Frame = -2

Query: 198 RVLSIACS*SC*CTPTLWFVRPH 130
           RV+   CS +C     L  VRPH
Sbjct: 236 RVIPQVCSGNCKLNDILLTVRPH 258


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 205,286
Number of Sequences: 438
Number of extensions: 4252
Number of successful extensions: 14
Number of sequences better than 10.0: 12
Number of HSP's better than 10.0 without gapping: 14
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 14
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 23753925
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -