SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120038.Seq
         (762 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY268031-1|AAP23056.1|  810|Apis mellifera dorsal protein splice...    23   3.1  
AY242387-1|AAO72539.2|  693|Apis mellifera prophenoloxidase prot...    23   4.1  
DQ325089-1|ABD14103.1|  185|Apis mellifera complementary sex det...    22   5.4  
DQ325088-1|ABD14102.1|  185|Apis mellifera complementary sex det...    22   5.4  
DQ667193-1|ABG75745.1|  510|Apis mellifera cys-loop ligand-gated...    21   9.4  
DQ257415-1|ABB81846.1|  430|Apis mellifera yellow-like protein p...    21   9.4  
AF388659-1|AAK71995.1|  782|Apis mellifera 1D-myo-inositol-trisp...    21   9.4  

>AY268031-1|AAP23056.1|  810|Apis mellifera dorsal protein splice
           variant B protein.
          Length = 810

 Score = 23.0 bits (47), Expect = 3.1
 Identities = 10/25 (40%), Positives = 14/25 (56%)
 Frame = +2

Query: 419 ICDNLKYTEVSQAARNALYTAFTQL 493
           +CDN  YT +  A +N +   FT L
Sbjct: 576 VCDNQTYTSLQMAMKNPI--EFTDL 598


>AY242387-1|AAO72539.2|  693|Apis mellifera prophenoloxidase
           protein.
          Length = 693

 Score = 22.6 bits (46), Expect = 4.1
 Identities = 8/24 (33%), Positives = 12/24 (50%)
 Frame = +2

Query: 542 VARRIAFFRRDQRPNASRWCWRSI 613
           V  R+A++R D   N   W W  +
Sbjct: 192 VEHRVAYWREDIGINLHHWHWHLV 215


>DQ325089-1|ABD14103.1|  185|Apis mellifera complementary sex
           determiner protein.
          Length = 185

 Score = 22.2 bits (45), Expect = 5.4
 Identities = 9/17 (52%), Positives = 12/17 (70%)
 Frame = -3

Query: 571 TSKKRNSSRDTREQNVF 521
           T++KRNS    REQN +
Sbjct: 33  TNRKRNSRSREREQNSY 49


>DQ325088-1|ABD14102.1|  185|Apis mellifera complementary sex
           determiner protein.
          Length = 185

 Score = 22.2 bits (45), Expect = 5.4
 Identities = 9/17 (52%), Positives = 12/17 (70%)
 Frame = -3

Query: 571 TSKKRNSSRDTREQNVF 521
           T++KRNS    REQN +
Sbjct: 33  TNRKRNSRSREREQNSY 49


>DQ667193-1|ABG75745.1|  510|Apis mellifera cys-loop ligand-gated
           ion channel subunit protein.
          Length = 510

 Score = 21.4 bits (43), Expect = 9.4
 Identities = 10/37 (27%), Positives = 18/37 (48%)
 Frame = -1

Query: 312 IKIRLIPLSLFPTKCLAIVI*IDCRLRRKWAKPFLTF 202
           +K  ++  S+ P   L +   +DC  R+ W    L+F
Sbjct: 64  VKTNILIRSMGPVSELDMDYSMDCYFRQSWRDSRLSF 100


>DQ257415-1|ABB81846.1|  430|Apis mellifera yellow-like protein
           protein.
          Length = 430

 Score = 21.4 bits (43), Expect = 9.4
 Identities = 8/23 (34%), Positives = 13/23 (56%)
 Frame = +3

Query: 483 LRNYKKHSSTTNPNTFCSRVSRD 551
           LR Y+  +   N NTF + ++ D
Sbjct: 174 LRQYRLRAEDINMNTFIANIAVD 196


>AF388659-1|AAK71995.1|  782|Apis mellifera
           1D-myo-inositol-trisphosphate 3-kinaseisoform A protein.
          Length = 782

 Score = 21.4 bits (43), Expect = 9.4
 Identities = 14/42 (33%), Positives = 20/42 (47%), Gaps = 6/42 (14%)
 Frame = +3

Query: 483 LRNYKKHSSTTNPNTFCSRVSRDELR------FFDVTNARTH 590
           L  Y+  SST +  + CS +  DE+R      F  V  +R H
Sbjct: 310 LEKYEGISSTPSQASSCSCLDCDEIRESLDTQFLQVCRSRRH 351


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 218,308
Number of Sequences: 438
Number of extensions: 4786
Number of successful extensions: 13
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 13
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 13
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 23789892
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -