SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120035.Seq
         (749 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY703685-1|AAU12681.1|  200|Apis mellifera abdominal-A protein.        24   1.3  
DQ667188-1|ABG75740.1|  383|Apis mellifera histamine-gated chlor...    22   7.1  
AY569705-1|AAS86658.1|  419|Apis mellifera complementary sex det...    21   9.3  

>AY703685-1|AAU12681.1|  200|Apis mellifera abdominal-A protein.
          Length = 200

 Score = 24.2 bits (50), Expect = 1.3
 Identities = 13/66 (19%), Positives = 27/66 (40%)
 Frame = +3

Query: 27  NNQTTMTQINFNASYTSAPTPSRASFDNGYSEFCDKQQPNDYLNYYNNPTPDGADTVVSD 206
           ++Q   +  N         +P+ AS ++  S         +Y   +N+P+P G+    S 
Sbjct: 14  HHQQLFSSANPGTIQACTTSPATASLESSLSAAAVAAAAVNYAQQHNSPSPTGSSPQHSG 73

Query: 207 SETAAA 224
           S  + +
Sbjct: 74  SSASTS 79


>DQ667188-1|ABG75740.1|  383|Apis mellifera histamine-gated chloride
           channel protein.
          Length = 383

 Score = 21.8 bits (44), Expect = 7.1
 Identities = 8/24 (33%), Positives = 15/24 (62%)
 Frame = +3

Query: 522 KKSTIQSCATLEQTINHNTNICTV 593
           K + + SCA   ++  H+T IC++
Sbjct: 125 KLTLVLSCAMKFESYPHDTQICSM 148


>AY569705-1|AAS86658.1|  419|Apis mellifera complementary sex
           determiner protein.
          Length = 419

 Score = 21.4 bits (43), Expect = 9.3
 Identities = 5/27 (18%), Positives = 17/27 (62%)
 Frame = +3

Query: 663 NDYNSNRFSDHMSETGYYMFVVKKSEV 743
           N+YN+N ++++  +  Y  +++   ++
Sbjct: 331 NNYNNNNYNNYNKKLYYKNYIINIEQI 357


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 202,053
Number of Sequences: 438
Number of extensions: 4514
Number of successful extensions: 7
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 23510295
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -