SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120033.Seq
         (717 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ011226-1|AAY63895.1|  471|Apis mellifera Rh-like protein protein.    23   2.2  
AY375535-1|AAQ82648.1|  147|Apis mellifera doublesex protein.          23   2.9  
AY569719-1|AAS86672.1|  401|Apis mellifera feminizer protein.          23   3.8  
AY569718-1|AAS86671.1|  401|Apis mellifera feminizer protein.          23   3.8  
AY569715-1|AAS86668.1|  401|Apis mellifera feminizer protein.          23   3.8  
AY569714-1|AAS86667.1|  401|Apis mellifera feminizer protein.          23   3.8  
AY569713-1|AAS86666.1|  401|Apis mellifera feminizer protein.          23   3.8  
AY569711-1|AAS86664.1|  401|Apis mellifera feminizer protein.          23   3.8  
AY569702-1|AAS86655.1|  400|Apis mellifera feminizer protein.          23   3.8  
AY350616-1|AAQ57658.1|  401|Apis mellifera complementary sex det...    23   3.8  
DQ342041-1|ABC69933.1|  828|Apis mellifera STIP protein.               22   5.0  
AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase...    22   5.0  
DQ869051-1|ABJ09598.1|  581|Apis mellifera pyrokinin-like recept...    21   8.8  
AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso...    21   8.8  
AF015267-1|AAC38959.1|  461|Apis mellifera elongation factor-1al...    21   8.8  
AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul...    21   8.8  
AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A...    21   8.8  

>DQ011226-1|AAY63895.1|  471|Apis mellifera Rh-like protein protein.
          Length = 471

 Score = 23.4 bits (48), Expect = 2.2
 Identities = 8/17 (47%), Positives = 15/17 (88%)
 Frame = +3

Query: 357 MGVLKIIIDTVIKYIGK 407
           MG++++I+ TV KY+G+
Sbjct: 146 MGIVELIMFTVNKYVGE 162


>AY375535-1|AAQ82648.1|  147|Apis mellifera doublesex protein.
          Length = 147

 Score = 23.0 bits (47), Expect = 2.9
 Identities = 9/13 (69%), Positives = 11/13 (84%)
 Frame = +3

Query: 156 KRHVAHDRVKQRV 194
           KRH+A D+VK RV
Sbjct: 26  KRHLAQDKVKVRV 38


>AY569719-1|AAS86672.1|  401|Apis mellifera feminizer protein.
          Length = 401

 Score = 22.6 bits (46), Expect = 3.8
 Identities = 8/18 (44%), Positives = 11/18 (61%)
 Frame = +2

Query: 329 KRRRGWRTQHGRFKDHHR 382
           +RRR W  Q  R ++H R
Sbjct: 37  RRRREWMIQQEREREHER 54


>AY569718-1|AAS86671.1|  401|Apis mellifera feminizer protein.
          Length = 401

 Score = 22.6 bits (46), Expect = 3.8
 Identities = 8/18 (44%), Positives = 11/18 (61%)
 Frame = +2

Query: 329 KRRRGWRTQHGRFKDHHR 382
           +RRR W  Q  R ++H R
Sbjct: 37  RRRREWMIQQEREREHER 54


>AY569715-1|AAS86668.1|  401|Apis mellifera feminizer protein.
          Length = 401

 Score = 22.6 bits (46), Expect = 3.8
 Identities = 8/18 (44%), Positives = 11/18 (61%)
 Frame = +2

Query: 329 KRRRGWRTQHGRFKDHHR 382
           +RRR W  Q  R ++H R
Sbjct: 37  RRRREWMIQQEREREHER 54


>AY569714-1|AAS86667.1|  401|Apis mellifera feminizer protein.
          Length = 401

 Score = 22.6 bits (46), Expect = 3.8
 Identities = 8/18 (44%), Positives = 11/18 (61%)
 Frame = +2

Query: 329 KRRRGWRTQHGRFKDHHR 382
           +RRR W  Q  R ++H R
Sbjct: 37  RRRREWMIQQEREREHER 54


>AY569713-1|AAS86666.1|  401|Apis mellifera feminizer protein.
          Length = 401

 Score = 22.6 bits (46), Expect = 3.8
 Identities = 8/18 (44%), Positives = 11/18 (61%)
 Frame = +2

Query: 329 KRRRGWRTQHGRFKDHHR 382
           +RRR W  Q  R ++H R
Sbjct: 37  RRRREWMIQQEREREHER 54


>AY569711-1|AAS86664.1|  401|Apis mellifera feminizer protein.
          Length = 401

 Score = 22.6 bits (46), Expect = 3.8
 Identities = 8/18 (44%), Positives = 11/18 (61%)
 Frame = +2

Query: 329 KRRRGWRTQHGRFKDHHR 382
           +RRR W  Q  R ++H R
Sbjct: 37  RRRREWMIQQEREREHER 54


>AY569702-1|AAS86655.1|  400|Apis mellifera feminizer protein.
          Length = 400

 Score = 22.6 bits (46), Expect = 3.8
 Identities = 8/18 (44%), Positives = 11/18 (61%)
 Frame = +2

Query: 329 KRRRGWRTQHGRFKDHHR 382
           +RRR W  Q  R ++H R
Sbjct: 37  RRRREWMIQQEREREHER 54


>AY350616-1|AAQ57658.1|  401|Apis mellifera complementary sex
           determiner protein.
          Length = 401

 Score = 22.6 bits (46), Expect = 3.8
 Identities = 8/18 (44%), Positives = 11/18 (61%)
 Frame = +2

Query: 329 KRRRGWRTQHGRFKDHHR 382
           +RRR W  Q  R ++H R
Sbjct: 37  RRRREWMIQQEREREHER 54


>DQ342041-1|ABC69933.1|  828|Apis mellifera STIP protein.
          Length = 828

 Score = 22.2 bits (45), Expect = 5.0
 Identities = 11/31 (35%), Positives = 15/31 (48%), Gaps = 4/31 (12%)
 Frame = +1

Query: 16  LDLCASVKLT----PFKPMRPPKPMQCWIHP 96
           LD+    KLT     + P+    P+  WIHP
Sbjct: 515 LDMLVLPKLTLEVEEWNPLTDTVPIHTWIHP 545


>AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase
           protein.
          Length = 1143

 Score = 22.2 bits (45), Expect = 5.0
 Identities = 15/56 (26%), Positives = 23/56 (41%)
 Frame = +2

Query: 539 SGQSVDVCNELKYPWNLITANSFIVSTDESRQSQYIYRTFLLYNTVLTAILKQNNP 706
           SG    +CN +KY  N     S I    +    ++ YR   ++N  L +     NP
Sbjct: 147 SGMFEALCNHIKYSTNKGNIRSAITIFPQRTDGKHDYR---VWNHQLISYAGYKNP 199


>DQ869051-1|ABJ09598.1|  581|Apis mellifera pyrokinin-like receptor
           2 protein.
          Length = 581

 Score = 21.4 bits (43), Expect = 8.8
 Identities = 7/16 (43%), Positives = 10/16 (62%)
 Frame = +2

Query: 374 HHRYGHQVHWQTGRRR 421
           +H  G   HW +GRR+
Sbjct: 261 NHLSGGTNHWDSGRRK 276


>AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor
            protein.
          Length = 1770

 Score = 21.4 bits (43), Expect = 8.8
 Identities = 12/25 (48%), Positives = 14/25 (56%)
 Frame = +1

Query: 118  TRPRNNYSDPDNENDMLHMTVLNSV 192
            T PR N   PDN N+ LH+    SV
Sbjct: 1473 TYPRIN---PDNHNEKLHIPKDKSV 1494


>AF015267-1|AAC38959.1|  461|Apis mellifera elongation factor-1alpha
           F2 protein.
          Length = 461

 Score = 21.4 bits (43), Expect = 8.8
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = -2

Query: 707 MDCFV*ELRSKLYCTKEKCDK 645
           +DC    +  K    KEKCD+
Sbjct: 361 LDCHTAHIACKFADIKEKCDR 381


>AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule
            AbsCAM-Ig7B protein.
          Length = 1923

 Score = 21.4 bits (43), Expect = 8.8
 Identities = 10/32 (31%), Positives = 16/32 (50%)
 Frame = +3

Query: 303  KPIRTEHFRSVDEAGEHNMGVLKIIIDTVIKY 398
            +PI  + +RSVDE        L  ++  + KY
Sbjct: 1152 EPILADMWRSVDEMEVRKTSALTTVLTGLRKY 1183


>AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member
            AbsCAM-Ig7A protein.
          Length = 1919

 Score = 21.4 bits (43), Expect = 8.8
 Identities = 10/32 (31%), Positives = 16/32 (50%)
 Frame = +3

Query: 303  KPIRTEHFRSVDEAGEHNMGVLKIIIDTVIKY 398
            +PI  + +RSVDE        L  ++  + KY
Sbjct: 1148 EPILADMWRSVDEMEVRKTSALTTVLTGLRKY 1179


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 181,132
Number of Sequences: 438
Number of extensions: 4134
Number of successful extensions: 41
Number of sequences better than 10.0: 17
Number of HSP's better than 10.0 without gapping: 41
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 41
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 22170330
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -