SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120031.Seq
         (726 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM050259-1|CAJ18340.1|  683|Apis mellifera putative H3K9 methylt...    25   0.55 
D79207-1|BAA23639.1|  432|Apis mellifera milk protein protein.         23   3.9  
AF514804-1|AAM51823.1|  537|Apis mellifera neuronal nicotinic ac...    23   3.9  
AF388203-1|AAM73637.1|  432|Apis mellifera major royal jelly pro...    23   3.9  
AF000633-1|AAC61895.1|  432|Apis mellifera major royal jelly pro...    23   3.9  
DQ855482-1|ABH88169.1|  116|Apis mellifera chemosensory protein ...    22   6.8  
DQ026031-1|AAY87890.1|  601|Apis mellifera nicotinic acetylcholi...    22   6.8  
AJ973399-1|CAJ01446.1|  116|Apis mellifera hypothetical protein ...    22   6.8  
AY823258-1|AAX18443.1|  145|Apis mellifera pburs protein.              21   9.0  
AM420632-1|CAM06632.1|  145|Apis mellifera bursicon subunit beta...    21   9.0  

>AM050259-1|CAJ18340.1|  683|Apis mellifera putative H3K9
           methyltransferase protein.
          Length = 683

 Score = 25.4 bits (53), Expect = 0.55
 Identities = 9/16 (56%), Positives = 13/16 (81%)
 Frame = -2

Query: 320 NTQNGISKLLAKTTIW 273
           NT+NG+  LL++T IW
Sbjct: 229 NTKNGMKTLLSETDIW 244


>D79207-1|BAA23639.1|  432|Apis mellifera milk protein protein.
          Length = 432

 Score = 22.6 bits (46), Expect = 3.9
 Identities = 13/53 (24%), Positives = 26/53 (49%), Gaps = 4/53 (7%)
 Frame = -3

Query: 193 KSGVSGIMATSKTIVLYLCQAPATASLYVSAD----TDADEPIIYFENITECL 47
           + G+SG+  +  T  LY     +T+  YV+ +    +D  +  I++E +   L
Sbjct: 250 QDGISGMALSPMTNNLYYSPVASTSLYYVNTEQFRTSDYQQNDIHYEGVQNIL 302


>AF514804-1|AAM51823.1|  537|Apis mellifera neuronal nicotinic
           acetylcholine receptoralpha-3 protein.
          Length = 537

 Score = 22.6 bits (46), Expect = 3.9
 Identities = 8/14 (57%), Positives = 10/14 (71%)
 Frame = +3

Query: 465 PRVLLTRLPPYGTP 506
           PR+L+ R  PY TP
Sbjct: 359 PRLLMMRRTPYSTP 372


>AF388203-1|AAM73637.1|  432|Apis mellifera major royal jelly
           protein MRJP1 protein.
          Length = 432

 Score = 22.6 bits (46), Expect = 3.9
 Identities = 13/53 (24%), Positives = 26/53 (49%), Gaps = 4/53 (7%)
 Frame = -3

Query: 193 KSGVSGIMATSKTIVLYLCQAPATASLYVSAD----TDADEPIIYFENITECL 47
           + G+SG+  +  T  LY     +T+  YV+ +    +D  +  I++E +   L
Sbjct: 250 QDGISGMALSPMTNNLYYSPVASTSLYYVNTEQFRTSDYQQNDIHYEGVQNIL 302


>AF000633-1|AAC61895.1|  432|Apis mellifera major royal jelly
           protein MRJP1 protein.
          Length = 432

 Score = 22.6 bits (46), Expect = 3.9
 Identities = 13/53 (24%), Positives = 26/53 (49%), Gaps = 4/53 (7%)
 Frame = -3

Query: 193 KSGVSGIMATSKTIVLYLCQAPATASLYVSAD----TDADEPIIYFENITECL 47
           + G+SG+  +  T  LY     +T+  YV+ +    +D  +  I++E +   L
Sbjct: 250 QDGISGMALSPMTNNLYYSPVASTSLYYVNTEQFRTSDYQQNDIHYEGVQNIL 302


>DQ855482-1|ABH88169.1|  116|Apis mellifera chemosensory protein 1
           protein.
          Length = 116

 Score = 21.8 bits (44), Expect = 6.8
 Identities = 11/36 (30%), Positives = 16/36 (44%)
 Frame = +2

Query: 287 SQATYLYHFACLMKYKDIQKYEVQQLIEWAINASPD 394
           S  T  +   C  K  +IQK  + +L EW     P+
Sbjct: 65  SHITEAFQTQC-KKCTEIQKQNLDKLAEWFTTNEPE 99


>DQ026031-1|AAY87890.1|  601|Apis mellifera nicotinic acetylcholine
           receptor alpha1subunit protein.
          Length = 601

 Score = 21.8 bits (44), Expect = 6.8
 Identities = 16/54 (29%), Positives = 25/54 (46%)
 Frame = +3

Query: 156 VLLVAMIPLTPLFSRYKDSYLLYSFRLIDLLRALNRRTLPNCCLRKQLTYTILR 317
           +LL  +IP T L       YLL++  L+ L   +    L N   R  +T+ + R
Sbjct: 283 LLLAEIIPPTSLTVPLLGKYLLFTMVLVTLSVVVTIAVL-NVNFRSPVTHRMAR 335


>AJ973399-1|CAJ01446.1|  116|Apis mellifera hypothetical protein
           protein.
          Length = 116

 Score = 21.8 bits (44), Expect = 6.8
 Identities = 11/36 (30%), Positives = 16/36 (44%)
 Frame = +2

Query: 287 SQATYLYHFACLMKYKDIQKYEVQQLIEWAINASPD 394
           S  T  +   C  K  +IQK  + +L EW     P+
Sbjct: 65  SHITEAFQTQC-KKCTEIQKQNLDKLAEWFTTNEPE 99


>AY823258-1|AAX18443.1|  145|Apis mellifera pburs protein.
          Length = 145

 Score = 21.4 bits (43), Expect = 9.0
 Identities = 6/22 (27%), Positives = 12/22 (54%)
 Frame = +1

Query: 619 FILQCAMCRDHYMNVKGFLIYH 684
           F  +C  CR+ Y+  +   ++H
Sbjct: 87  FSKECYCCRESYLKERHITLHH 108


>AM420632-1|CAM06632.1|  145|Apis mellifera bursicon subunit beta
           protein precursor protein.
          Length = 145

 Score = 21.4 bits (43), Expect = 9.0
 Identities = 6/22 (27%), Positives = 12/22 (54%)
 Frame = +1

Query: 619 FILQCAMCRDHYMNVKGFLIYH 684
           F  +C  CR+ Y+  +   ++H
Sbjct: 87  FSKECYCCRESYLKERHITLHH 108


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 203,609
Number of Sequences: 438
Number of extensions: 3970
Number of successful extensions: 14
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 13
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 14
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 22535775
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -