SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120028.Seq
         (721 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF069739-1|AAC63272.2|  690|Apis mellifera translation initiatio...    23   2.2  
DQ435324-1|ABD92639.1|  152|Apis mellifera OBP3 protein.               22   5.1  
AY242387-1|AAO72539.2|  693|Apis mellifera prophenoloxidase prot...    22   5.1  
Z26319-1|CAA81228.1|  464|Apis mellifera royal jelly protein RJP...    21   8.9  
AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr...    21   8.9  

>AF069739-1|AAC63272.2|  690|Apis mellifera translation initiation
           factor 2 protein.
          Length = 690

 Score = 23.4 bits (48), Expect = 2.2
 Identities = 15/51 (29%), Positives = 23/51 (45%)
 Frame = +1

Query: 331 QVYHLNEIIFHKQKSKRDLNSLGALFATKQGLLKILMRLNFDNKSNALLHL 483
           Q YH+  + F KQK  ++   L       +  L  LM   F NKS  ++ +
Sbjct: 9   QHYHITPV-FTKQKKVKEDTELNLQTIFNEDKLDNLMDKQFKNKSLPVIEI 58


>DQ435324-1|ABD92639.1|  152|Apis mellifera OBP3 protein.
          Length = 152

 Score = 22.2 bits (45), Expect = 5.1
 Identities = 9/32 (28%), Positives = 18/32 (56%)
 Frame = +3

Query: 621 QFELRLNELDAKLNMLQSAEKLKTAIVTESKN 716
           +F++ LN+ D  +++  S  K+    V  +KN
Sbjct: 76  KFDVYLNDTDMDMDLKDSIRKIIRQCVDNAKN 107


>AY242387-1|AAO72539.2|  693|Apis mellifera prophenoloxidase
           protein.
          Length = 693

 Score = 22.2 bits (45), Expect = 5.1
 Identities = 12/45 (26%), Positives = 21/45 (46%)
 Frame = +3

Query: 510 RDKIESVLKHVKKLNTNSEKFMVTHETFKNDVGNRFEQFELRLNE 644
           RD+I   +     +NT  E+  +T +   + +GN  E   L  N+
Sbjct: 314 RDRIYEAIHTGSVINTRGERIQLTEKNGIDVLGNIMEASILSPNQ 358


>Z26319-1|CAA81228.1|  464|Apis mellifera royal jelly protein
           RJP57-2 protein.
          Length = 464

 Score = 21.4 bits (43), Expect = 8.9
 Identities = 12/42 (28%), Positives = 17/42 (40%)
 Frame = +2

Query: 122 FDPDDYKKYHINVQQ*SHIVKWDSFKCNTHSFKYRYVHNDTN 247
           FD  D   Y+ N  Q  H  K D+   N H+ +  +     N
Sbjct: 417 FDNQDNNHYNHNHNQARHSSKSDNQNNNQHNDQAHHSSKSNN 458


>AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor
           protein.
          Length = 1370

 Score = 21.4 bits (43), Expect = 8.9
 Identities = 10/40 (25%), Positives = 19/40 (47%)
 Frame = +3

Query: 567 KFMVTHETFKNDVGNRFEQFELRLNELDAKLNMLQSAEKL 686
           K++  H  F   +GN ++  + ++  LDA  N +     L
Sbjct: 574 KWLDIHGNFIESLGNYYKIRDSKVKTLDASHNRITELSPL 613


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 166,305
Number of Sequences: 438
Number of extensions: 3355
Number of successful extensions: 9
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 22292145
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -