SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120027.Seq
         (774 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY703685-1|AAU12681.1|  200|Apis mellifera abdominal-A protein.        24   1.4  
EF625897-1|ABR45904.1|  684|Apis mellifera hexamerin protein.          22   5.5  
EF591128-1|ABQ59246.1|  684|Apis mellifera hexamerin 70a protein.      22   5.5  
AY127579-1|AAN02286.1|  405|Apis mellifera venom protease precur...    22   7.3  

>AY703685-1|AAU12681.1|  200|Apis mellifera abdominal-A protein.
          Length = 200

 Score = 24.2 bits (50), Expect = 1.4
 Identities = 13/66 (19%), Positives = 27/66 (40%)
 Frame = +3

Query: 264 NNQTTMTQINFNASYTSAPTPSRASFDNGYSEFCDKQQPNDYLNYYNNPTPDGADTVVSD 443
           ++Q   +  N         +P+ AS ++  S         +Y   +N+P+P G+    S 
Sbjct: 14  HHQQLFSSANPGTIQACTTSPATASLESSLSAAAVAAAAVNYAQQHNSPSPTGSSPQHSG 73

Query: 444 SETAAA 461
           S  + +
Sbjct: 74  SSASTS 79


>EF625897-1|ABR45904.1|  684|Apis mellifera hexamerin protein.
          Length = 684

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 12/33 (36%), Positives = 19/33 (57%)
 Frame = -3

Query: 238 LAKKCRAHHKDIDIFKHLCPELQIDNSVVQLES 140
           +  K  +HHK I+I + L    +IDN ++ L S
Sbjct: 520 IGPKYDSHHKLIEIPEDLKYFYEIDNWMLDLNS 552


>EF591128-1|ABQ59246.1|  684|Apis mellifera hexamerin 70a protein.
          Length = 684

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 12/33 (36%), Positives = 19/33 (57%)
 Frame = -3

Query: 238 LAKKCRAHHKDIDIFKHLCPELQIDNSVVQLES 140
           +  K  +HHK I+I + L    +IDN ++ L S
Sbjct: 520 IGPKYDSHHKLIEIPEDLKYFYEIDNWMLDLNS 552


>AY127579-1|AAN02286.1|  405|Apis mellifera venom protease precursor
           protein.
          Length = 405

 Score = 21.8 bits (44), Expect = 7.3
 Identities = 8/15 (53%), Positives = 9/15 (60%)
 Frame = -2

Query: 83  DRTR*ACSWPSPSRI 39
           D T   C W +PSRI
Sbjct: 147 DSTNCNCGWKNPSRI 161


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 211,080
Number of Sequences: 438
Number of extensions: 4393
Number of successful extensions: 7
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 24275400
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -