SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120026.Seq
         (729 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ011226-1|AAY63895.1|  471|Apis mellifera Rh-like protein protein.    24   1.3  
AB231585-1|BAE17127.1|  898|Apis mellifera Mahya protein.              23   2.2  
AY569719-1|AAS86672.1|  401|Apis mellifera feminizer protein.          23   3.9  
AY569718-1|AAS86671.1|  401|Apis mellifera feminizer protein.          23   3.9  
AY569715-1|AAS86668.1|  401|Apis mellifera feminizer protein.          23   3.9  
AY569714-1|AAS86667.1|  401|Apis mellifera feminizer protein.          23   3.9  
AY569713-1|AAS86666.1|  401|Apis mellifera feminizer protein.          23   3.9  
AY569711-1|AAS86664.1|  401|Apis mellifera feminizer protein.          23   3.9  
AY569702-1|AAS86655.1|  400|Apis mellifera feminizer protein.          23   3.9  
AY350616-1|AAQ57658.1|  401|Apis mellifera complementary sex det...    23   3.9  
AY569701-1|AAS86654.1|  407|Apis mellifera complementary sex det...    21   9.0  
AY569700-1|AAS86653.1|  407|Apis mellifera complementary sex det...    21   9.0  

>DQ011226-1|AAY63895.1|  471|Apis mellifera Rh-like protein protein.
          Length = 471

 Score = 24.2 bits (50), Expect = 1.3
 Identities = 12/37 (32%), Positives = 18/37 (48%)
 Frame = -1

Query: 627 SFNSAKFALVSTAVCLFLLAGIAALSLEDDDVDRSAI 517
           S+NS  FA++ T           + +LE DD  R+ I
Sbjct: 206 SYNSDIFAMIGTIFLWLFWPSFNSAALEGDDQQRAII 242


>AB231585-1|BAE17127.1|  898|Apis mellifera Mahya protein.
          Length = 898

 Score = 23.4 bits (48), Expect = 2.2
 Identities = 10/33 (30%), Positives = 17/33 (51%)
 Frame = -2

Query: 353 LLAFGHFAFVLHDRHYVEDIVNVLFFQEIYNSN 255
           LL + H   +  D H  E +V+++F     N+N
Sbjct: 218 LLLYNHARLMSQDNHSKEYLVSIMFSHYDRNNN 250


>AY569719-1|AAS86672.1|  401|Apis mellifera feminizer protein.
          Length = 401

 Score = 22.6 bits (46), Expect = 3.9
 Identities = 13/42 (30%), Positives = 19/42 (45%)
 Frame = +1

Query: 100 IQAGRFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESS 225
           ++  R K L K +    PE +  +  +   K   L  KLESS
Sbjct: 65  LRRAREKKLSKRSKSRSPESRGRSNASNTSKTFILSEKLESS 106


>AY569718-1|AAS86671.1|  401|Apis mellifera feminizer protein.
          Length = 401

 Score = 22.6 bits (46), Expect = 3.9
 Identities = 13/42 (30%), Positives = 19/42 (45%)
 Frame = +1

Query: 100 IQAGRFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESS 225
           ++  R K L K +    PE +  +  +   K   L  KLESS
Sbjct: 65  LRRAREKKLSKRSKSRSPESRGRSNASNTSKTFILSEKLESS 106


>AY569715-1|AAS86668.1|  401|Apis mellifera feminizer protein.
          Length = 401

 Score = 22.6 bits (46), Expect = 3.9
 Identities = 13/42 (30%), Positives = 19/42 (45%)
 Frame = +1

Query: 100 IQAGRFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESS 225
           ++  R K L K +    PE +  +  +   K   L  KLESS
Sbjct: 65  LRRAREKKLSKRSKSRSPESRGRSNASNTSKTFILSEKLESS 106


>AY569714-1|AAS86667.1|  401|Apis mellifera feminizer protein.
          Length = 401

 Score = 22.6 bits (46), Expect = 3.9
 Identities = 13/42 (30%), Positives = 19/42 (45%)
 Frame = +1

Query: 100 IQAGRFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESS 225
           ++  R K L K +    PE +  +  +   K   L  KLESS
Sbjct: 65  LRRAREKKLSKRSKSRSPESRGRSNASNTSKTFILSEKLESS 106


>AY569713-1|AAS86666.1|  401|Apis mellifera feminizer protein.
          Length = 401

 Score = 22.6 bits (46), Expect = 3.9
 Identities = 13/42 (30%), Positives = 19/42 (45%)
 Frame = +1

Query: 100 IQAGRFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESS 225
           ++  R K L K +    PE +  +  +   K   L  KLESS
Sbjct: 65  LRRAREKKLSKRSKSRSPESRGRSNASNTSKTFILSEKLESS 106


>AY569711-1|AAS86664.1|  401|Apis mellifera feminizer protein.
          Length = 401

 Score = 22.6 bits (46), Expect = 3.9
 Identities = 13/42 (30%), Positives = 19/42 (45%)
 Frame = +1

Query: 100 IQAGRFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESS 225
           ++  R K L K +    PE +  +  +   K   L  KLESS
Sbjct: 65  LRRAREKKLSKRSKSRSPESRGRSNASNTSKTFILSEKLESS 106


>AY569702-1|AAS86655.1|  400|Apis mellifera feminizer protein.
          Length = 400

 Score = 22.6 bits (46), Expect = 3.9
 Identities = 13/42 (30%), Positives = 19/42 (45%)
 Frame = +1

Query: 100 IQAGRFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESS 225
           ++  R K L K +    PE +  +  +   K   L  KLESS
Sbjct: 65  LRRAREKKLSKRSKSRSPESRGRSNASNTSKTFILSEKLESS 106


>AY350616-1|AAQ57658.1|  401|Apis mellifera complementary sex
           determiner protein.
          Length = 401

 Score = 22.6 bits (46), Expect = 3.9
 Identities = 13/42 (30%), Positives = 19/42 (45%)
 Frame = +1

Query: 100 IQAGRFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESS 225
           ++  R K L K +    PE +  +  +   K   L  KLESS
Sbjct: 65  LRRAREKKLSKRSKSRSPESRGRSNASNTSKTFILSEKLESS 106


>AY569701-1|AAS86654.1|  407|Apis mellifera complementary sex
           determiner protein.
          Length = 407

 Score = 21.4 bits (43), Expect = 9.0
 Identities = 10/25 (40%), Positives = 14/25 (56%)
 Frame = +1

Query: 151 PEQQSSTETAAVCKNEKLLNKLESS 225
           P+ +  + T+   K   L NKLESS
Sbjct: 85  PDSRDRSSTSNTSKTVILSNKLESS 109


>AY569700-1|AAS86653.1|  407|Apis mellifera complementary sex
           determiner protein.
          Length = 407

 Score = 21.4 bits (43), Expect = 9.0
 Identities = 10/25 (40%), Positives = 14/25 (56%)
 Frame = +1

Query: 151 PEQQSSTETAAVCKNEKLLNKLESS 225
           P+ +  + T+   K   L NKLESS
Sbjct: 85  PDSRDRSNTSNTSKTVILSNKLESS 109


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 206,258
Number of Sequences: 438
Number of extensions: 4511
Number of successful extensions: 18
Number of sequences better than 10.0: 12
Number of HSP's better than 10.0 without gapping: 18
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 18
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 22657590
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -