SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120024.Seq
         (770 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF127800-1|ABL67937.1|  461|Apis mellifera nicotinic acetylcholi...    24   1.8  
DQ026036-1|AAY87895.1|  529|Apis mellifera nicotinic acetylcholi...    24   1.8  
DQ026035-1|AAY87894.1|  529|Apis mellifera nicotinic acetylcholi...    24   1.8  
L10710-1|AAA27730.1|  382|Apis mellifera hyaluronidase protein.        23   2.4  
EF127805-1|ABL67942.1|  461|Apis mellifera nicotinic acetylcholi...    23   2.4  
EF127804-1|ABL67941.1|  461|Apis mellifera nicotinic acetylcholi...    23   2.4  
EF127803-1|ABL67940.1|  461|Apis mellifera nicotinic acetylcholi...    23   2.4  
EF127802-1|ABL67939.1|  461|Apis mellifera nicotinic acetylcholi...    23   2.4  
EF127801-1|ABL67938.1|  461|Apis mellifera nicotinic acetylcholi...    23   2.4  
AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.              22   5.5  
AF388659-1|AAK71995.1|  782|Apis mellifera 1D-myo-inositol-trisp...    21   9.6  

>EF127800-1|ABL67937.1|  461|Apis mellifera nicotinic acetylcholine
           receptor subunitalpha 6 transcript variant 1 protein.
          Length = 461

 Score = 23.8 bits (49), Expect = 1.8
 Identities = 11/29 (37%), Positives = 16/29 (55%), Gaps = 1/29 (3%)
 Frame = -1

Query: 299 LWKPDLVM-KFCSLQVDQTNNIEVVISHH 216
           LWKPD++M        D T    VV++H+
Sbjct: 68  LWKPDILMYNSADEGFDGTYQTSVVVTHN 96


>DQ026036-1|AAY87895.1|  529|Apis mellifera nicotinic acetylcholine
           receptor alpha6subunit protein.
          Length = 529

 Score = 23.8 bits (49), Expect = 1.8
 Identities = 11/29 (37%), Positives = 16/29 (55%), Gaps = 1/29 (3%)
 Frame = -1

Query: 299 LWKPDLVM-KFCSLQVDQTNNIEVVISHH 216
           LWKPD++M        D T    VV++H+
Sbjct: 136 LWKPDILMYNSADEGFDGTYQTNVVVTHN 164


>DQ026035-1|AAY87894.1|  529|Apis mellifera nicotinic acetylcholine
           receptor alpha6subunit protein.
          Length = 529

 Score = 23.8 bits (49), Expect = 1.8
 Identities = 11/29 (37%), Positives = 16/29 (55%), Gaps = 1/29 (3%)
 Frame = -1

Query: 299 LWKPDLVM-KFCSLQVDQTNNIEVVISHH 216
           LWKPD++M        D T    VV++H+
Sbjct: 136 LWKPDILMYNSADEGFDGTYQTNVVVTHN 164


>L10710-1|AAA27730.1|  382|Apis mellifera hyaluronidase protein.
          Length = 382

 Score = 23.4 bits (48), Expect = 2.4
 Identities = 10/28 (35%), Positives = 15/28 (53%)
 Frame = -1

Query: 296 WKPDLVMKFCSLQVDQTNNIEVVISHHP 213
           W+P     + SLQ  +  ++EVV   HP
Sbjct: 147 WRPIFRQNWASLQPYKKLSVEVVRREHP 174


>EF127805-1|ABL67942.1|  461|Apis mellifera nicotinic acetylcholine
           receptor subunitalpha 6 transcript variant 6 protein.
          Length = 461

 Score = 23.4 bits (48), Expect = 2.4
 Identities = 11/28 (39%), Positives = 15/28 (53%), Gaps = 1/28 (3%)
 Frame = -1

Query: 299 LWKPDLVM-KFCSLQVDQTNNIEVVISH 219
           LWKPD++M        D T    VV++H
Sbjct: 68  LWKPDILMYNSADEGFDGTYQTSVVVTH 95


>EF127804-1|ABL67941.1|  461|Apis mellifera nicotinic acetylcholine
           receptor subunitalpha 6 transcript variant 5 protein.
          Length = 461

 Score = 23.4 bits (48), Expect = 2.4
 Identities = 11/28 (39%), Positives = 15/28 (53%), Gaps = 1/28 (3%)
 Frame = -1

Query: 299 LWKPDLVM-KFCSLQVDQTNNIEVVISH 219
           LWKPD++M        D T    VV++H
Sbjct: 68  LWKPDILMYNSADEGFDGTYQTSVVVTH 95


>EF127803-1|ABL67940.1|  461|Apis mellifera nicotinic acetylcholine
           receptor subunitalpha 6 transcript variant 4 protein.
          Length = 461

 Score = 23.4 bits (48), Expect = 2.4
 Identities = 11/28 (39%), Positives = 15/28 (53%), Gaps = 1/28 (3%)
 Frame = -1

Query: 299 LWKPDLVM-KFCSLQVDQTNNIEVVISH 219
           LWKPD++M        D T    VV++H
Sbjct: 68  LWKPDILMYNSADEGFDGTYQTSVVVTH 95


>EF127802-1|ABL67939.1|  461|Apis mellifera nicotinic acetylcholine
           receptor subunitalpha 6 transcript variant 3 protein.
          Length = 461

 Score = 23.4 bits (48), Expect = 2.4
 Identities = 11/28 (39%), Positives = 15/28 (53%), Gaps = 1/28 (3%)
 Frame = -1

Query: 299 LWKPDLVM-KFCSLQVDQTNNIEVVISH 219
           LWKPD++M        D T    VV++H
Sbjct: 68  LWKPDILMYNSADEGFDGTYQTSVVVTH 95


>EF127801-1|ABL67938.1|  461|Apis mellifera nicotinic acetylcholine
           receptor subunitalpha 6 transcript variant 2 protein.
          Length = 461

 Score = 23.4 bits (48), Expect = 2.4
 Identities = 11/28 (39%), Positives = 15/28 (53%), Gaps = 1/28 (3%)
 Frame = -1

Query: 299 LWKPDLVM-KFCSLQVDQTNNIEVVISH 219
           LWKPD++M        D T    VV++H
Sbjct: 68  LWKPDILMYNSADEGFDGTYQTSVVVTH 95


>AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.
          Length = 1946

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 10/31 (32%), Positives = 15/31 (48%)
 Frame = +1

Query: 340 TSPRGVKIDGDDSSWDFGVSAGFYLDATNEP 432
           T+P G +I+    + DFG  A F  +    P
Sbjct: 305 TAPLGAEIEPSTQTIDFGRPATFTCNVRGNP 335


>AF388659-1|AAK71995.1|  782|Apis mellifera
           1D-myo-inositol-trisphosphate 3-kinaseisoform A protein.
          Length = 782

 Score = 21.4 bits (43), Expect = 9.6
 Identities = 8/20 (40%), Positives = 13/20 (65%)
 Frame = -1

Query: 98  ASCPCLISDELRKNYIHNYL 39
           +SC CL  DE+R++    +L
Sbjct: 324 SSCSCLDCDEIRESLDTQFL 343


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 233,615
Number of Sequences: 438
Number of extensions: 5516
Number of successful extensions: 17
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 17
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 17
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 24154023
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -