SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120021.Seq
         (683 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ026036-1|AAY87895.1|  529|Apis mellifera nicotinic acetylcholi...    24   1.6  
DQ026035-1|AAY87894.1|  529|Apis mellifera nicotinic acetylcholi...    23   2.1  
EF127805-1|ABL67942.1|  461|Apis mellifera nicotinic acetylcholi...    23   3.6  
EF127804-1|ABL67941.1|  461|Apis mellifera nicotinic acetylcholi...    23   3.6  
EF127803-1|ABL67940.1|  461|Apis mellifera nicotinic acetylcholi...    23   3.6  
AY242387-1|AAO72539.2|  693|Apis mellifera prophenoloxidase prot...    23   3.6  
EF127802-1|ABL67939.1|  461|Apis mellifera nicotinic acetylcholi...    22   4.7  
EF127801-1|ABL67938.1|  461|Apis mellifera nicotinic acetylcholi...    22   4.7  
EF127800-1|ABL67937.1|  461|Apis mellifera nicotinic acetylcholi...    22   4.7  
AB267886-1|BAF46356.1|  567|Apis mellifera ecdysteroid receptor ...    22   4.7  
AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ...    22   6.3  
AB050744-1|BAB17753.1|  238|Apis mellifera period protein protein.     22   6.3  

>DQ026036-1|AAY87895.1|  529|Apis mellifera nicotinic acetylcholine
           receptor alpha6subunit protein.
          Length = 529

 Score = 23.8 bits (49), Expect = 1.6
 Identities = 16/58 (27%), Positives = 26/58 (44%), Gaps = 1/58 (1%)
 Frame = +1

Query: 370 VFLRLEAPNVLAIR-TLQLSFSKFTKASVSNSRLSILTIDGLSTEHNTPPRFL*TKWV 540
           VFL L A  +  +   + L  S F       +   +LT+  L+  H TP R++   W+
Sbjct: 306 VFLNLVAETLPQVSDAIPLLGSYFNCIMFMVASSVVLTVLVLNFHHRTPDRYVMPSWI 363


>DQ026035-1|AAY87894.1|  529|Apis mellifera nicotinic acetylcholine
           receptor alpha6subunit protein.
          Length = 529

 Score = 23.4 bits (48), Expect = 2.1
 Identities = 8/23 (34%), Positives = 14/23 (60%)
 Frame = +1

Query: 472 ILTIDGLSTEHNTPPRFL*TKWV 540
           +LT+  L+  H TP R++   W+
Sbjct: 341 VLTVLVLNFHHRTPDRYVMPSWI 363


>EF127805-1|ABL67942.1|  461|Apis mellifera nicotinic acetylcholine
           receptor subunitalpha 6 transcript variant 6 protein.
          Length = 461

 Score = 22.6 bits (46), Expect = 3.6
 Identities = 16/58 (27%), Positives = 25/58 (43%), Gaps = 1/58 (1%)
 Frame = +1

Query: 370 VFLRLEAPNVLAIR-TLQLSFSKFTKASVSNSRLSILTIDGLSTEHNTPPRFL*TKWV 540
           VFL L A  +  +   + L  S F       +   +LT+  L   H TP R++   W+
Sbjct: 238 VFLNLVAETLPQVSDAIPLLGSYFNCIMFMVASSVVLTVLVLIFHHRTPDRYVMPSWI 295


>EF127804-1|ABL67941.1|  461|Apis mellifera nicotinic acetylcholine
           receptor subunitalpha 6 transcript variant 5 protein.
          Length = 461

 Score = 22.6 bits (46), Expect = 3.6
 Identities = 16/58 (27%), Positives = 25/58 (43%), Gaps = 1/58 (1%)
 Frame = +1

Query: 370 VFLRLEAPNVLAIR-TLQLSFSKFTKASVSNSRLSILTIDGLSTEHNTPPRFL*TKWV 540
           VFL L A  +  +   + L  S F       +   +LT+  L   H TP R++   W+
Sbjct: 238 VFLNLVAETLPQVSDAIPLLGSYFNCIMFMVASSVVLTVLVLIFHHRTPDRYVMPSWI 295


>EF127803-1|ABL67940.1|  461|Apis mellifera nicotinic acetylcholine
           receptor subunitalpha 6 transcript variant 4 protein.
          Length = 461

 Score = 22.6 bits (46), Expect = 3.6
 Identities = 16/58 (27%), Positives = 25/58 (43%), Gaps = 1/58 (1%)
 Frame = +1

Query: 370 VFLRLEAPNVLAIR-TLQLSFSKFTKASVSNSRLSILTIDGLSTEHNTPPRFL*TKWV 540
           VFL L A  +  +   + L  S F       +   +LT+  L   H TP R++   W+
Sbjct: 238 VFLNLVAETLPQVSDAIPLLGSYFNCIMFMVASSVVLTVLVLIFHHRTPDRYVMPSWI 295


>AY242387-1|AAO72539.2|  693|Apis mellifera prophenoloxidase
           protein.
          Length = 693

 Score = 22.6 bits (46), Expect = 3.6
 Identities = 7/23 (30%), Positives = 16/23 (69%)
 Frame = +3

Query: 513 PSFSVNKMGSPGMLVSLVSVTTN 581
           P ++V ++  PG+ ++ + +TTN
Sbjct: 420 PQYTVQQLDFPGIEIADIKLTTN 442


>EF127802-1|ABL67939.1|  461|Apis mellifera nicotinic acetylcholine
           receptor subunitalpha 6 transcript variant 3 protein.
          Length = 461

 Score = 22.2 bits (45), Expect = 4.7
 Identities = 8/23 (34%), Positives = 13/23 (56%)
 Frame = +1

Query: 472 ILTIDGLSTEHNTPPRFL*TKWV 540
           +LT+  L   H TP R++   W+
Sbjct: 273 VLTVLVLIFHHRTPDRYVMPSWI 295


>EF127801-1|ABL67938.1|  461|Apis mellifera nicotinic acetylcholine
           receptor subunitalpha 6 transcript variant 2 protein.
          Length = 461

 Score = 22.2 bits (45), Expect = 4.7
 Identities = 8/23 (34%), Positives = 13/23 (56%)
 Frame = +1

Query: 472 ILTIDGLSTEHNTPPRFL*TKWV 540
           +LT+  L   H TP R++   W+
Sbjct: 273 VLTVLVLIFHHRTPDRYVMPSWI 295


>EF127800-1|ABL67937.1|  461|Apis mellifera nicotinic acetylcholine
           receptor subunitalpha 6 transcript variant 1 protein.
          Length = 461

 Score = 22.2 bits (45), Expect = 4.7
 Identities = 8/23 (34%), Positives = 13/23 (56%)
 Frame = +1

Query: 472 ILTIDGLSTEHNTPPRFL*TKWV 540
           +LT+  L   H TP R++   W+
Sbjct: 273 VLTVLVLIFHHRTPDRYVMPSWI 295


>AB267886-1|BAF46356.1|  567|Apis mellifera ecdysteroid receptor A
           isoform protein.
          Length = 567

 Score = 22.2 bits (45), Expect = 4.7
 Identities = 10/28 (35%), Positives = 14/28 (50%)
 Frame = -1

Query: 338 QPDYDMDLSDFSITEVEATQYLTLLLIV 255
           QP    D+SD+    +     LT+ LIV
Sbjct: 363 QPSEGEDISDYKFRHITEITILTVQLIV 390


>AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein
           protein.
          Length = 1124

 Score = 21.8 bits (44), Expect = 6.3
 Identities = 13/51 (25%), Positives = 22/51 (43%)
 Frame = -2

Query: 631 IHNRFHPLVTNFTNKMEFVVTETNDTSIPGEPILFTENEGVCCAPSTDRLS 479
           +   +   +  +T K+EFVV +      P  P +F     V CA    +L+
Sbjct: 387 LETEWSSFINPWTKKLEFVVGQHRILKGPANPDIFR----VSCATEHSQLT 433


>AB050744-1|BAB17753.1|  238|Apis mellifera period protein protein.
          Length = 238

 Score = 21.8 bits (44), Expect = 6.3
 Identities = 13/51 (25%), Positives = 22/51 (43%)
 Frame = -2

Query: 631 IHNRFHPLVTNFTNKMEFVVTETNDTSIPGEPILFTENEGVCCAPSTDRLS 479
           +   +   +  +T K+EFVV +      P  P +F     V CA    +L+
Sbjct: 93  LETEWSSFINPWTKKLEFVVGQHRILKGPANPDIFR----VSCATEHSQLT 139


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 157,974
Number of Sequences: 438
Number of extensions: 3042
Number of successful extensions: 18
Number of sequences better than 10.0: 12
Number of HSP's better than 10.0 without gapping: 18
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 18
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 20830365
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -