SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120020.Seq
         (726 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB264313-1|BAF43600.1|  900|Apis mellifera ecdysone-induced prot...    26   0.42 
AF084556-1|AAC71015.1|  652|Apis mellifera pipsqueak protein.          25   0.96 
DQ325075-1|ABD14089.1|  181|Apis mellifera complementary sex det...    24   1.7  
DQ325074-1|ABD14088.1|  181|Apis mellifera complementary sex det...    24   1.7  
DQ325073-1|ABD14087.1|  181|Apis mellifera complementary sex det...    24   1.7  
DQ325072-1|ABD14086.1|  181|Apis mellifera complementary sex det...    24   1.7  
DQ325071-1|ABD14085.1|  181|Apis mellifera complementary sex det...    24   1.7  
DQ325070-1|ABD14084.1|  181|Apis mellifera complementary sex det...    24   1.7  
DQ325069-1|ABD14083.1|  181|Apis mellifera complementary sex det...    24   1.7  
DQ325068-1|ABD14082.1|  181|Apis mellifera complementary sex det...    24   1.7  
AY569696-1|AAS86649.1|  414|Apis mellifera complementary sex det...    24   1.7  
AY569695-1|AAS86648.1|  414|Apis mellifera complementary sex det...    24   1.7  
DQ325133-1|ABD14147.1|  181|Apis mellifera complementary sex det...    23   2.9  
DQ435337-1|ABD92652.1|  135|Apis mellifera OBP20 protein.              23   3.9  
DQ435336-1|ABD92651.1|  135|Apis mellifera OBP19 protein.              23   3.9  
AB264335-1|BAF44090.1|   87|Apis mellifera ecdysone-induced prot...    23   3.9  
DQ011227-1|AAY63896.1|  484|Apis mellifera Amt-1-like protein pr...    22   5.1  
AF015267-1|AAC38959.1|  461|Apis mellifera elongation factor-1al...    21   9.0  

>AB264313-1|BAF43600.1|  900|Apis mellifera ecdysone-induced protein
           75 protein.
          Length = 900

 Score = 25.8 bits (54), Expect = 0.42
 Identities = 15/53 (28%), Positives = 24/53 (45%)
 Frame = +2

Query: 302 KGFSLRKVG*KPQQVQTIQRINCAPIRSRRRICEFTRKRKQPATCSRRVSITF 460
           KGF  R +  K Q     +   C+ +R  R  C++ R +K  A    R ++ F
Sbjct: 88  KGFFRRSIQQKIQYRPCTKNQQCSILRINRNRCQYCRLKKCIAVGMSRDAVRF 140


>AF084556-1|AAC71015.1|  652|Apis mellifera pipsqueak protein.
          Length = 652

 Score = 24.6 bits (51), Expect = 0.96
 Identities = 16/73 (21%), Positives = 31/73 (42%)
 Frame = +3

Query: 255 GIPPGHVMCPPREITKKVFHYAKWVRNPNKYKRYSELIARQSEAGGASASLRENVNNQLH 434
           G P   +  PPRE      ++ K  R+  +YKR       ++         +E  +N+ +
Sbjct: 129 GPPSVSLSSPPREPGTPRINFTKLKRHHPRYKRPRTTFEPRATDSRHYDRYKEEESNENY 188

Query: 435 ARDASQLHLLDWE 473
             +  + H +DW+
Sbjct: 189 NWEHKETH-IDWQ 200


>DQ325075-1|ABD14089.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 23.8 bits (49), Expect = 1.7
 Identities = 8/24 (33%), Positives = 15/24 (62%)
 Frame = +1

Query: 589 DSCIHNYEKSSAWKNYRKHNRKQI 660
           +S  +NY  ++ + NY KHN  ++
Sbjct: 86  NSLSNNYNYNNNYNNYNKHNYNKL 109


>DQ325074-1|ABD14088.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 23.8 bits (49), Expect = 1.7
 Identities = 8/24 (33%), Positives = 15/24 (62%)
 Frame = +1

Query: 589 DSCIHNYEKSSAWKNYRKHNRKQI 660
           +S  +NY  ++ + NY KHN  ++
Sbjct: 86  NSLSNNYNYNNNYNNYNKHNYNKL 109


>DQ325073-1|ABD14087.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 23.8 bits (49), Expect = 1.7
 Identities = 8/24 (33%), Positives = 15/24 (62%)
 Frame = +1

Query: 589 DSCIHNYEKSSAWKNYRKHNRKQI 660
           +S  +NY  ++ + NY KHN  ++
Sbjct: 86  NSLSNNYNYNNNYNNYNKHNYNKL 109


>DQ325072-1|ABD14086.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 23.8 bits (49), Expect = 1.7
 Identities = 8/24 (33%), Positives = 15/24 (62%)
 Frame = +1

Query: 589 DSCIHNYEKSSAWKNYRKHNRKQI 660
           +S  +NY  ++ + NY KHN  ++
Sbjct: 86  NSLSNNYNYNNNYNNYNKHNYNKL 109


>DQ325071-1|ABD14085.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 23.8 bits (49), Expect = 1.7
 Identities = 8/24 (33%), Positives = 15/24 (62%)
 Frame = +1

Query: 589 DSCIHNYEKSSAWKNYRKHNRKQI 660
           +S  +NY  ++ + NY KHN  ++
Sbjct: 86  NSLSNNYNYNNNYNNYNKHNYNKL 109


>DQ325070-1|ABD14084.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 23.8 bits (49), Expect = 1.7
 Identities = 8/24 (33%), Positives = 15/24 (62%)
 Frame = +1

Query: 589 DSCIHNYEKSSAWKNYRKHNRKQI 660
           +S  +NY  ++ + NY KHN  ++
Sbjct: 86  NSLSNNYNYNNNYNNYNKHNYNKL 109


>DQ325069-1|ABD14083.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 23.8 bits (49), Expect = 1.7
 Identities = 8/24 (33%), Positives = 15/24 (62%)
 Frame = +1

Query: 589 DSCIHNYEKSSAWKNYRKHNRKQI 660
           +S  +NY  ++ + NY KHN  ++
Sbjct: 86  NSLSNNYNYNNNYNNYNKHNYNKL 109


>DQ325068-1|ABD14082.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 23.8 bits (49), Expect = 1.7
 Identities = 8/24 (33%), Positives = 15/24 (62%)
 Frame = +1

Query: 589 DSCIHNYEKSSAWKNYRKHNRKQI 660
           +S  +NY  ++ + NY KHN  ++
Sbjct: 86  NSLSNNYNYNNNYNNYNKHNYNKL 109


>AY569696-1|AAS86649.1|  414|Apis mellifera complementary sex
           determiner protein.
          Length = 414

 Score = 23.8 bits (49), Expect = 1.7
 Identities = 8/24 (33%), Positives = 15/24 (62%)
 Frame = +1

Query: 589 DSCIHNYEKSSAWKNYRKHNRKQI 660
           +S  +NY  ++ + NY KHN  ++
Sbjct: 319 NSLSNNYNYNNNYNNYNKHNYNKL 342


>AY569695-1|AAS86648.1|  414|Apis mellifera complementary sex
           determiner protein.
          Length = 414

 Score = 23.8 bits (49), Expect = 1.7
 Identities = 8/24 (33%), Positives = 15/24 (62%)
 Frame = +1

Query: 589 DSCIHNYEKSSAWKNYRKHNRKQI 660
           +S  +NY  ++ + NY KHN  ++
Sbjct: 319 NSLSNNYNYNNNYNNYNKHNYNKL 342


>DQ325133-1|ABD14147.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 23.0 bits (47), Expect = 2.9
 Identities = 7/20 (35%), Positives = 13/20 (65%)
 Frame = +1

Query: 601 HNYEKSSAWKNYRKHNRKQI 660
           +NY  ++ + NY KHN  ++
Sbjct: 90  NNYNYNNNYNNYNKHNYNKL 109


>DQ435337-1|ABD92652.1|  135|Apis mellifera OBP20 protein.
          Length = 135

 Score = 22.6 bits (46), Expect = 3.9
 Identities = 10/30 (33%), Positives = 17/30 (56%)
 Frame = +3

Query: 342 KYKRYSELIARQSEAGGASASLRENVNNQL 431
           K +RY+E I +Q      S + +EN+  +L
Sbjct: 58  KPQRYNECILKQFNIVDESGNFKENIVQEL 87


>DQ435336-1|ABD92651.1|  135|Apis mellifera OBP19 protein.
          Length = 135

 Score = 22.6 bits (46), Expect = 3.9
 Identities = 10/30 (33%), Positives = 17/30 (56%)
 Frame = +3

Query: 342 KYKRYSELIARQSEAGGASASLRENVNNQL 431
           K +RY+E I +Q      S + +EN+  +L
Sbjct: 58  KPQRYNECILKQFNIVDESGNFKENIVQEL 87


>AB264335-1|BAF44090.1|   87|Apis mellifera ecdysone-induced protein
           75 protein.
          Length = 87

 Score = 22.6 bits (46), Expect = 3.9
 Identities = 11/40 (27%), Positives = 19/40 (47%)
 Frame = +2

Query: 302 KGFSLRKVG*KPQQVQTIQRINCAPIRSRRRICEFTRKRK 421
           +GF  R +  K Q     +   C+ +R  R  C++ R +K
Sbjct: 39  QGFFRRSIQQKIQYRPCTKNQQCSILRINRNRCQYCRLKK 78


>DQ011227-1|AAY63896.1|  484|Apis mellifera Amt-1-like protein
           protein.
          Length = 484

 Score = 22.2 bits (45), Expect = 5.1
 Identities = 9/20 (45%), Positives = 13/20 (65%)
 Frame = -1

Query: 270 VPAGCPVIEIAALYSIFVVW 211
           +P GCPV    A+  +FV+W
Sbjct: 216 LPLGCPV---NAIMGLFVLW 232


>AF015267-1|AAC38959.1|  461|Apis mellifera elongation factor-1alpha
           F2 protein.
          Length = 461

 Score = 21.4 bits (43), Expect = 9.0
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = -3

Query: 151 MDCFV*ELRSKLYCTKEKCDK 89
           +DC    +  K    KEKCD+
Sbjct: 361 LDCHTAHIACKFADIKEKCDR 381


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 191,827
Number of Sequences: 438
Number of extensions: 3872
Number of successful extensions: 24
Number of sequences better than 10.0: 18
Number of HSP's better than 10.0 without gapping: 24
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 24
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 22535775
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -