SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120018.Seq
         (789 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr...    25   0.80 
AB253415-1|BAE86926.1|  588|Apis mellifera alpha-glucosidase pro...    25   1.1  
AB193550-1|BAD66824.1|  699|Apis mellifera soluble guanylyl cycl...    23   3.2  
AY398690-1|AAR83734.1|  416|Apis mellifera major royal jelly pro...    23   4.3  
AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso...    22   7.5  
DQ011228-1|AAY63897.1|  486|Apis mellifera Amt-2-like protein pr...    21   9.9  

>AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor
           protein.
          Length = 1370

 Score = 25.0 bits (52), Expect = 0.80
 Identities = 11/33 (33%), Positives = 20/33 (60%)
 Frame = +3

Query: 69  YSMINFLQCRPFNDPRVWKMLNKNNDSTNRIKS 167
           Y+M+  +  R F D    ++L+  N+S +RI+S
Sbjct: 344 YNMLTHIDARMFKDLFFLQILDLRNNSIDRIES 376


>AB253415-1|BAE86926.1|  588|Apis mellifera alpha-glucosidase
           protein.
          Length = 588

 Score = 24.6 bits (51), Expect = 1.1
 Identities = 13/53 (24%), Positives = 27/53 (50%)
 Frame = +3

Query: 75  MINFLQCRPFNDPRVWKMLNKNNDSTNRIKSIIKKIVLKRDKSEISFNIPKHT 233
           +INF +     D  + K++NK N++     S+   + + +  + ++ NIP  T
Sbjct: 506 LINFSKNNTIVD--ISKLVNKRNNAKIYTSSVNSNLTVNQTVNPVAINIPGDT 556


>AB193550-1|BAD66824.1|  699|Apis mellifera soluble guanylyl cyclase
           alpha 1 subunit protein.
          Length = 699

 Score = 23.0 bits (47), Expect = 3.2
 Identities = 7/16 (43%), Positives = 10/16 (62%)
 Frame = +2

Query: 371 QHVLWLILKLRQICCH 418
           Q + W+ LK+ Q C H
Sbjct: 557 QQIAWMALKMIQACSH 572



 Score = 22.2 bits (45), Expect = 5.7
 Identities = 12/27 (44%), Positives = 14/27 (51%)
 Frame = +2

Query: 281 DKLKCESEEAYMKAVAARESENTLSRL 361
           DKLK   EEA +   A RE   +L  L
Sbjct: 440 DKLKSSIEEANLAVSAEREKNVSLLHL 466


>AY398690-1|AAR83734.1|  416|Apis mellifera major royal jelly
           protein 8 protein.
          Length = 416

 Score = 22.6 bits (46), Expect = 4.3
 Identities = 9/24 (37%), Positives = 12/24 (50%)
 Frame = +2

Query: 377 VLWLILKLRQICCHPYLAMHGRNL 448
           + WL+L    I C     +H RNL
Sbjct: 2   IRWLLLMYLGITCQGVTDIHSRNL 25


>AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor
           protein.
          Length = 1770

 Score = 21.8 bits (44), Expect = 7.5
 Identities = 9/19 (47%), Positives = 10/19 (52%)
 Frame = -3

Query: 121 HTLGSLKGRHCKKLIIEYI 65
           HT G L  +H   L  EYI
Sbjct: 593 HTFGRLTSKHDNSLYDEYI 611


>DQ011228-1|AAY63897.1|  486|Apis mellifera Amt-2-like protein
           protein.
          Length = 486

 Score = 21.4 bits (43), Expect = 9.9
 Identities = 6/11 (54%), Positives = 8/11 (72%)
 Frame = -1

Query: 432 MAKYGWQQICL 400
           +  +GWQ ICL
Sbjct: 394 LLNFGWQMICL 404


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 214,381
Number of Sequences: 438
Number of extensions: 4736
Number of successful extensions: 11
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 10
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 24882285
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -