SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120017.Seq
         (731 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY268031-1|AAP23056.1|  810|Apis mellifera dorsal protein splice...    26   0.32 
AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.             26   0.42 
AM050259-1|CAJ18340.1|  683|Apis mellifera putative H3K9 methylt...    25   0.73 
AB264313-1|BAF43600.1|  900|Apis mellifera ecdysone-induced prot...    24   1.3  
AF498306-5|AAM19330.1|  456|Apis mellifera dopamine receptor typ...    23   3.0  
AB208106-1|BAE72138.1|  111|Apis mellifera Broad complex zinc fi...    23   3.9  
AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.              21   9.0  
AB267886-1|BAF46356.1|  567|Apis mellifera ecdysteroid receptor ...    21   9.0  

>AY268031-1|AAP23056.1|  810|Apis mellifera dorsal protein splice
           variant B protein.
          Length = 810

 Score = 26.2 bits (55), Expect = 0.32
 Identities = 15/56 (26%), Positives = 26/56 (46%), Gaps = 2/56 (3%)
 Frame = +1

Query: 103 YNNAPGYVPPTTRDNKMDTSRSNSTNSVAIAPYNKSKEPTLDAGESIWYNNV--WI 264
           Y + P Y+   T+D  ++ S    +N+V  A   K+ E   D  +   Y+ V  W+
Sbjct: 454 YKSYPNYIDKETKDMNLEISTRPKSNTVENACVLKNTEIFKDKSDWFDYSEVSKWV 509


>AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.
          Length = 1598

 Score = 25.8 bits (54), Expect = 0.42
 Identities = 15/44 (34%), Positives = 23/44 (52%)
 Frame = +3

Query: 102  LQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRR 233
            LQ++ R  A    +QQ   + QQQ +    +  QQ+Q+  AR R
Sbjct: 1198 LQEQQRNAAMVQQQQQQQQQQQQQQQ--QQQQQQQQQQHQARER 1239



 Score = 25.0 bits (52), Expect = 0.73
 Identities = 14/56 (25%), Positives = 26/56 (46%), Gaps = 2/56 (3%)
 Frame = +3

Query: 81   HIHQRANLQQRARVRAAYDARQ--QNGHEPQQQHKLGSDRTVQQEQRTDARRRRIY 242
            H  Q+   QQ  + +     +Q  Q   +PQQQ      +  QQ+Q+   ++++ Y
Sbjct: 1495 HSSQKTQQQQPQQQQQQQQQQQPQQQSQQPQQQQPQPQQQQQQQQQQQPQQQQKEY 1550



 Score = 24.2 bits (50), Expect = 1.3
 Identities = 15/45 (33%), Positives = 23/45 (51%)
 Frame = +3

Query: 81  HIHQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQR 215
           H HQ  + Q +A+ +     +QQ    PQQQ +    +  QQ+QR
Sbjct: 815 HHHQSTHPQAQAQAQPQQQQQQQQQQ-PQQQQQ--QQQQQQQQQR 856



 Score = 23.8 bits (49), Expect = 1.7
 Identities = 12/43 (27%), Positives = 20/43 (46%)
 Frame = +3

Query: 87  HQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQR 215
           HQ+ +  Q    +A   A+ Q   + QQQ      +  QQ+Q+
Sbjct: 811 HQQLHHHQSTHPQAQAQAQPQQQQQQQQQQPQQQQQQQQQQQQ 853


>AM050259-1|CAJ18340.1|  683|Apis mellifera putative H3K9
           methyltransferase protein.
          Length = 683

 Score = 25.0 bits (52), Expect = 0.73
 Identities = 19/67 (28%), Positives = 31/67 (46%), Gaps = 19/67 (28%)
 Frame = +1

Query: 112 APGYVPPTTRDNKMD-------------------TSRSNSTNSVAIAPYNKSKEPTLDAG 234
           +PGYV P T+  K+D                   ++ SNS+NS  +   NK +E T++  
Sbjct: 113 SPGYVQPPTKHQKLDQKFIFPQENNYNDNYFYSKSNGSNSSNSDVLFKQNKEEEQTINRK 172

Query: 235 ESIWYNN 255
            S + +N
Sbjct: 173 NSDYLDN 179


>AB264313-1|BAF43600.1|  900|Apis mellifera ecdysone-induced protein
           75 protein.
          Length = 900

 Score = 24.2 bits (50), Expect = 1.3
 Identities = 11/42 (26%), Positives = 23/42 (54%)
 Frame = +3

Query: 90  QRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQR 215
           Q+ + QQ+ + +   +A+Q    + QQQ +    +  QQ+Q+
Sbjct: 421 QQQHQQQQQQTQHVINAQQPQQQQQQQQQQQQQQQQQQQQQQ 462



 Score = 22.6 bits (46), Expect = 3.9
 Identities = 11/42 (26%), Positives = 20/42 (47%)
 Frame = +3

Query: 90  QRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQR 215
           Q+   QQ+ + +        N  +PQQQ +    +  QQ+Q+
Sbjct: 416 QQMQAQQQHQQQQQQTQHVINAQQPQQQQQQQQQQQQQQQQQ 457



 Score = 22.2 bits (45), Expect = 5.2
 Identities = 12/50 (24%), Positives = 28/50 (56%)
 Frame = +3

Query: 105 QQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRRRIYLVQQ 254
           +Q+ +++A    +QQ   + Q QH + + +  QQ+Q+   ++++    QQ
Sbjct: 413 EQQQQMQAQQQHQQQ---QQQTQHVINAQQPQQQQQQQQQQQQQQQQQQQ 459


>AF498306-5|AAM19330.1|  456|Apis mellifera dopamine receptor type
           D2 protein.
          Length = 456

 Score = 23.0 bits (47), Expect = 3.0
 Identities = 8/21 (38%), Positives = 12/21 (57%)
 Frame = -2

Query: 253 CCTK*IRRRRASVLCSCCTVR 191
           C ++  RR    +LC+CC  R
Sbjct: 392 CWSRDFRRAFVRILCACCPGR 412


>AB208106-1|BAE72138.1|  111|Apis mellifera Broad complex zinc
           finger domain-Z1 isoform protein.
          Length = 111

 Score = 22.6 bits (46), Expect = 3.9
 Identities = 10/38 (26%), Positives = 20/38 (52%)
 Frame = +3

Query: 102 LQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQR 215
           +++R R +  +  R  +  + QQQ +   D+  QQ+ R
Sbjct: 72  MREREREQREHSDRVTSQQQQQQQQQQQQDQQQQQQSR 109


>AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.
          Length = 1946

 Score = 21.4 bits (43), Expect = 9.0
 Identities = 10/31 (32%), Positives = 16/31 (51%)
 Frame = -3

Query: 492  SNRSAGTRPRCLVPTLFATESGGVSWSPPIQ 400
            + + A   P  +   + ++ES  VSW PP Q
Sbjct: 1175 TEQDAPEAPIAIKALVMSSESILVSWRPPSQ 1205


>AB267886-1|BAF46356.1|  567|Apis mellifera ecdysteroid receptor A
           isoform protein.
          Length = 567

 Score = 21.4 bits (43), Expect = 9.0
 Identities = 8/16 (50%), Positives = 12/16 (75%)
 Frame = +3

Query: 135 DARQQNGHEPQQQHKL 182
           DAR++ G  P+QQ +L
Sbjct: 171 DARKKKGPTPRQQEEL 186


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 205,369
Number of Sequences: 438
Number of extensions: 4481
Number of successful extensions: 28
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 17
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 26
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 22779405
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -