SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120016.Seq
         (678 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ026032-1|AAY87891.1|  566|Apis mellifera nicotinic acetylcholi...    23   3.5  
DQ015969-1|AAY81926.1|  397|Apis mellifera stargazin related pro...    23   3.5  
AF084556-1|AAC71015.1|  652|Apis mellifera pipsqueak protein.          22   4.7  
AY268031-1|AAP23056.1|  810|Apis mellifera dorsal protein splice...    21   8.2  
AB167961-1|BAD51404.1|  554|Apis mellifera E74 protein.                21   8.2  

>DQ026032-1|AAY87891.1|  566|Apis mellifera nicotinic acetylcholine
           receptor alpha3subunit protein.
          Length = 566

 Score = 22.6 bits (46), Expect = 3.5
 Identities = 17/55 (30%), Positives = 25/55 (45%), Gaps = 2/55 (3%)
 Frame = +1

Query: 442 YRRFLRNAAKLQAPLVNAIVATEVKVSHR--SLGHLSSKNALMPVKIACHLQLWW 600
           Y   L N  KL  P+VN   A  VK+  +   L  ++ KN +M   +    Q W+
Sbjct: 29  YDDLLSNYNKLVRPVVNVTDALTVKIKLKLSQLIDVNLKNQIMTTNLWVE-QSWY 82


>DQ015969-1|AAY81926.1|  397|Apis mellifera stargazin related
           protein STG-1 protein.
          Length = 397

 Score = 22.6 bits (46), Expect = 3.5
 Identities = 7/13 (53%), Positives = 9/13 (69%)
 Frame = -2

Query: 245 KEYEGVQHVEEHH 207
           K Y GV H++ HH
Sbjct: 268 KNYGGVYHLDNHH 280


>AF084556-1|AAC71015.1|  652|Apis mellifera pipsqueak protein.
          Length = 652

 Score = 22.2 bits (45), Expect = 4.7
 Identities = 9/15 (60%), Positives = 9/15 (60%)
 Frame = +3

Query: 522 TPITWTPELEECFNA 566
           T I W PE EEC  A
Sbjct: 195 THIDWQPEDEECTEA 209


>AY268031-1|AAP23056.1|  810|Apis mellifera dorsal protein splice
           variant B protein.
          Length = 810

 Score = 21.4 bits (43), Expect = 8.2
 Identities = 8/20 (40%), Positives = 14/20 (70%)
 Frame = -1

Query: 465 RIAQKSAIIINHPNETTESL 406
           ++ +   II+N P E+T+SL
Sbjct: 698 KVKKDKDIILNVPKESTQSL 717


>AB167961-1|BAD51404.1|  554|Apis mellifera E74 protein.
          Length = 554

 Score = 21.4 bits (43), Expect = 8.2
 Identities = 6/10 (60%), Positives = 8/10 (80%)
 Frame = +2

Query: 335 PPTEHNHHQS 364
           PP  H+HHQ+
Sbjct: 349 PPHHHHHHQT 358


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 174,507
Number of Sequences: 438
Number of extensions: 3358
Number of successful extensions: 6
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 20586735
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -