SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120009.Seq
         (721 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ026032-1|AAY87891.1|  566|Apis mellifera nicotinic acetylcholi...    24   1.7  
AY375535-1|AAQ82648.1|  147|Apis mellifera doublesex protein.          23   2.9  
AJ276511-1|CAC06383.1|  352|Apis mellifera Antennapedia protein ...    23   3.8  
DQ342041-1|ABC69933.1|  828|Apis mellifera STIP protein.               22   5.1  
DQ325089-1|ABD14103.1|  185|Apis mellifera complementary sex det...    22   5.1  
AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso...    21   8.9  

>DQ026032-1|AAY87891.1|  566|Apis mellifera nicotinic acetylcholine
           receptor alpha3subunit protein.
          Length = 566

 Score = 23.8 bits (49), Expect = 1.7
 Identities = 14/39 (35%), Positives = 21/39 (53%), Gaps = 1/39 (2%)
 Frame = +3

Query: 321 KLIAFTSAFINALHKKTPWTLNSILGIFLKNAIM-TNVW 434
           KL+       +AL  K    L+ ++ + LKN IM TN+W
Sbjct: 38  KLVRPVVNVTDALTVKIKLKLSQLIDVNLKNQIMTTNLW 76


>AY375535-1|AAQ82648.1|  147|Apis mellifera doublesex protein.
          Length = 147

 Score = 23.0 bits (47), Expect = 2.9
 Identities = 9/13 (69%), Positives = 11/13 (84%)
 Frame = +2

Query: 680 KRHVAHDRVKQRV 718
           KRH+A D+VK RV
Sbjct: 26  KRHLAQDKVKVRV 38


>AJ276511-1|CAC06383.1|  352|Apis mellifera Antennapedia protein
           protein.
          Length = 352

 Score = 22.6 bits (46), Expect = 3.8
 Identities = 10/41 (24%), Positives = 18/41 (43%)
 Frame = +3

Query: 69  PTCTTECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQ 191
           P     C++    +D  G ++  PD+  L   +M H+   Q
Sbjct: 135 PIVYASCKLQAAAVDHQGSVLDGPDSPPLVESQMHHQMHTQ 175


>DQ342041-1|ABC69933.1|  828|Apis mellifera STIP protein.
          Length = 828

 Score = 22.2 bits (45), Expect = 5.1
 Identities = 11/31 (35%), Positives = 15/31 (48%), Gaps = 4/31 (12%)
 Frame = +3

Query: 540 LDLCASVKLT----PFKPMRPPKPMQCWIHP 620
           LD+    KLT     + P+    P+  WIHP
Sbjct: 515 LDMLVLPKLTLEVEEWNPLTDTVPIHTWIHP 545


>DQ325089-1|ABD14103.1|  185|Apis mellifera complementary sex
           determiner protein.
          Length = 185

 Score = 22.2 bits (45), Expect = 5.1
 Identities = 12/40 (30%), Positives = 23/40 (57%), Gaps = 2/40 (5%)
 Frame = +1

Query: 259 KNARGMQRDAS--RNQRVYRRSRN*LRLQARLSTRYTRRR 372
           +N+R  +R+ +  +N+R YR+ R   + ++R  T   R R
Sbjct: 37  RNSRSREREQNSYKNEREYRKYRETSKERSRDRTERERSR 76


>AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor
            protein.
          Length = 1770

 Score = 21.4 bits (43), Expect = 8.9
 Identities = 12/25 (48%), Positives = 14/25 (56%)
 Frame = +3

Query: 642  TRPRNNYSDPDNENDMLHMTVLNSV 716
            T PR N   PDN N+ LH+    SV
Sbjct: 1473 TYPRIN---PDNHNEKLHIPKDKSV 1494


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 193,027
Number of Sequences: 438
Number of extensions: 4188
Number of successful extensions: 12
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 12
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 22292145
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -