SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120008.Seq
         (681 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ288391-1|ABC41341.1|  630|Apis mellifera vasa protein protein.       85   8e-19
EF625897-1|ABR45904.1|  684|Apis mellifera hexamerin protein.          21   8.2  
DQ667186-1|ABG75738.1|  447|Apis mellifera glutamate-gated chlor...    21   8.2  
DQ667185-1|ABG75737.1|  447|Apis mellifera glutamate-gated chlor...    21   8.2  

>DQ288391-1|ABC41341.1|  630|Apis mellifera vasa protein protein.
          Length = 630

 Score = 84.6 bits (200), Expect = 8e-19
 Identities = 43/82 (52%), Positives = 58/82 (70%), Gaps = 4/82 (4%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKII--EQIRP--DRQTLMWSAT 424
           GRL+DF+EKG        +LVLDEADRMLDMGF P I K++  E + P  +RQTLM+SAT
Sbjct: 332 GRLLDFVEKGRVKFSSVQFLVLDEADRMLDMGFLPSIEKMVDHETMVPLGERQTLMFSAT 391

Query: 425 WPKEVKKLAEDYLGDYIQINIG 490
           +P EV+ LA  +L +Y+ + +G
Sbjct: 392 FPDEVQHLARRFLNNYLFLAVG 413



 Score = 41.1 bits (92), Expect = 1e-05
 Identities = 27/88 (30%), Positives = 40/88 (45%), Gaps = 4/88 (4%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPP----IRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYV 170
           GSGKT A+ +P I  +  +            P  ++++PTREL  QI Q    F   S +
Sbjct: 243 GSGKTAAFAVPIINTLLERSVDLVVTSTYCEPQVVIVSPTRELTIQIWQQIVKFSLNSIL 302

Query: 171 RNTCVFGGAPKREQARDLERGVEIVIAT 254
           +    +GG     Q   L  G  I++AT
Sbjct: 303 KTVVAYGGTSVMHQRGKLSAGCHILVAT 330


>EF625897-1|ABR45904.1|  684|Apis mellifera hexamerin protein.
          Length = 684

 Score = 21.4 bits (43), Expect = 8.2
 Identities = 7/16 (43%), Positives = 12/16 (75%)
 Frame = +1

Query: 544 EHEKENKLNVLLQEIG 591
           ++  ENKLN  +++IG
Sbjct: 213 DYNLENKLNYFIEDIG 228


>DQ667186-1|ABG75738.1|  447|Apis mellifera glutamate-gated chloride
           channel protein.
          Length = 447

 Score = 21.4 bits (43), Expect = 8.2
 Identities = 14/47 (29%), Positives = 25/47 (53%)
 Frame = -3

Query: 649 SAFSWFQQKLLFLHQVLDFVQFLAIIHLIYFLFHVLDKYLQFEECCD 509
           +++ W    L+FL +  D VQ +  +HL  F    L+K+  F + C+
Sbjct: 179 ASYGWTTDDLVFLWKEGDPVQVVKNLHLPRF---TLEKF--FTDYCN 220


>DQ667185-1|ABG75737.1|  447|Apis mellifera glutamate-gated chloride
           channel protein.
          Length = 447

 Score = 21.4 bits (43), Expect = 8.2
 Identities = 14/47 (29%), Positives = 25/47 (53%)
 Frame = -3

Query: 649 SAFSWFQQKLLFLHQVLDFVQFLAIIHLIYFLFHVLDKYLQFEECCD 509
           +++ W    L+FL +  D VQ +  +HL  F    L+K+  F + C+
Sbjct: 179 ASYGWTTDDLVFLWKEGDPVQVVKNLHLPRF---TLEKF--FTDYCN 220


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 193,411
Number of Sequences: 438
Number of extensions: 4194
Number of successful extensions: 12
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 10
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 20708550
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -