SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120007.Seq
         (661 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.             30   0.023
AF469010-1|AAL93136.1|  678|Apis mellifera cGMP-dependent protei...    23   3.4  
AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso...    22   4.5  
AB264313-1|BAF43600.1|  900|Apis mellifera ecdysone-induced prot...    21   7.9  

>AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.
          Length = 1598

 Score = 29.9 bits (64), Expect = 0.023
 Identities = 26/124 (20%), Positives = 47/124 (37%), Gaps = 2/124 (1%)
 Frame = +2

Query: 113  ERERPVHHRGGRDRQP--GRHHGGDEDRVRLPGTTSPKFEVDAGEYKSSFSKQTSLIEHM 286
            E  +P    GG+  +P  G++   D D +        + E+      S +    S +E+ 
Sbjct: 1020 EANKPKPATGGKGTRPKRGKYRNYDRDSLVEAVRAVQRGEMSVHRAGSYYGVPHSTLEYK 1079

Query: 287  HNQEHLVETQMKDLKRLIVTASQSSAKSDAEIAKALSVVHQDLDEADKDRDLEPAKVSLE 466
              + HL+  + +D K+     S    K  + +  A +  +     AD    L+P K    
Sbjct: 1080 VKERHLMRPRKRDQKQ-----SDDKTKETSTVTAAAAATNIRPGTADNKPQLKPQKPFTS 1134

Query: 467  PNQI 478
            P  I
Sbjct: 1135 PGGI 1138



 Score = 21.4 bits (43), Expect = 7.9
 Identities = 10/27 (37%), Positives = 13/27 (48%)
 Frame = +1

Query: 307 RNSNEGSQTIDSHRLAVERQVGRGNSE 387
           +N  EG+   D      E + GRG SE
Sbjct: 271 QNDGEGADDRDDDEENEEEEDGRGQSE 297


>AF469010-1|AAL93136.1|  678|Apis mellifera cGMP-dependent protein
           kinase foraging protein.
          Length = 678

 Score = 22.6 bits (46), Expect = 3.4
 Identities = 9/18 (50%), Positives = 12/18 (66%)
 Frame = -3

Query: 425 QPRRDLGARLRGPSLFPR 372
           +PRR+ G   +GP  FPR
Sbjct: 53  EPRRNPGPGSKGPRDFPR 70


>AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor
           protein.
          Length = 1770

 Score = 22.2 bits (45), Expect = 4.5
 Identities = 9/20 (45%), Positives = 12/20 (60%)
 Frame = -3

Query: 149 PAPRDGVQDARAPGHLLLHH 90
           P  +D  + AR+  HLL HH
Sbjct: 749 PEWKDLAKKARSVNHLLTHH 768


>AB264313-1|BAF43600.1|  900|Apis mellifera ecdysone-induced protein
           75 protein.
          Length = 900

 Score = 21.4 bits (43), Expect = 7.9
 Identities = 12/35 (34%), Positives = 15/35 (42%)
 Frame = -1

Query: 586 QNQTSRVRAEY*HLN*LCPECCRILSEAHYYADAC 482
           +N   RV AE+     LC  C    S  HY   +C
Sbjct: 50  ENLLGRVLAEFDGTTVLCRVCGDKASGFHYGVHSC 84


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 180,539
Number of Sequences: 438
Number of extensions: 3995
Number of successful extensions: 12
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 10
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 19855845
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -