SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120006.Seq
         (617 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ968562-1|CAI91546.1|  998|Apis mellifera protein ( Apis mellif...    24   1.4  
AF388659-3|AAK71993.1|  548|Apis mellifera 1D-myo-inositol-trisp...    23   2.4  
AF388659-2|AAK71994.1|  463|Apis mellifera 1D-myo-inositol-trisp...    23   2.4  
AF388659-1|AAK71995.1|  782|Apis mellifera 1D-myo-inositol-trisp...    23   2.4  
DQ071552-1|AAY82248.1|  495|Apis mellifera anarchy 1 protein.          22   5.5  
AY336529-1|AAQ02340.1|  712|Apis mellifera transferrin protein.        22   5.5  
AY336528-1|AAQ02339.1|  712|Apis mellifera transferrin protein.        22   5.5  
AY217097-1|AAO39761.1|  712|Apis mellifera transferrin protein.        22   5.5  
DQ257631-1|ABB82366.1|  424|Apis mellifera yellow e3-like protei...    21   7.3  
DQ244074-1|ABB36784.1|  517|Apis mellifera cytochrome P450 monoo...    21   9.6  

>AJ968562-1|CAI91546.1|  998|Apis mellifera protein ( Apis mellifera
            ORF for hypotheticalprotein. ).
          Length = 998

 Score = 23.8 bits (49), Expect = 1.4
 Identities = 16/43 (37%), Positives = 22/43 (51%), Gaps = 3/43 (6%)
 Frame = +1

Query: 364  IDLGIKYDP-SIGIYGL--DFYVVLGRPGFNVAHRRRKTGKVG 483
            + +GI + P + G+ G     Y + G    NVA R   TGKVG
Sbjct: 894  LKMGINHGPVTAGVIGARKPHYDIWGNT-VNVASRMESTGKVG 935


>AF388659-3|AAK71993.1|  548|Apis mellifera
           1D-myo-inositol-trisphosphate 3-kinaseisoform C protein.
          Length = 548

 Score = 23.0 bits (47), Expect = 2.4
 Identities = 24/83 (28%), Positives = 35/83 (42%)
 Frame = +1

Query: 262 AEEILERGLKVREYELRRDNFSATGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGRPG 441
           AEE   +G+    Y + R+  S+T   GF ++     GIK   + G    DF     R  
Sbjct: 386 AEERRVQGVTKPRYMVWRETISSTATLGFRVE-----GIKL--AHGGSSKDFKTTRTREQ 438

Query: 442 FNVAHRRRKTGKVGFPHRLTKEV 510
              A RR      G+PH + K +
Sbjct: 439 VTEALRRFVE---GYPHAVPKYI 458


>AF388659-2|AAK71994.1|  463|Apis mellifera
           1D-myo-inositol-trisphosphate 3-kinaseisoform B protein.
          Length = 463

 Score = 23.0 bits (47), Expect = 2.4
 Identities = 24/83 (28%), Positives = 35/83 (42%)
 Frame = +1

Query: 262 AEEILERGLKVREYELRRDNFSATGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGRPG 441
           AEE   +G+    Y + R+  S+T   GF ++     GIK   + G    DF     R  
Sbjct: 301 AEERRVQGVTKPRYMVWRETISSTATLGFRVE-----GIKL--AHGGSSKDFKTTRTREQ 353

Query: 442 FNVAHRRRKTGKVGFPHRLTKEV 510
              A RR      G+PH + K +
Sbjct: 354 VTEALRRFVE---GYPHAVPKYI 373


>AF388659-1|AAK71995.1|  782|Apis mellifera
           1D-myo-inositol-trisphosphate 3-kinaseisoform A protein.
          Length = 782

 Score = 23.0 bits (47), Expect = 2.4
 Identities = 24/83 (28%), Positives = 35/83 (42%)
 Frame = +1

Query: 262 AEEILERGLKVREYELRRDNFSATGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGRPG 441
           AEE   +G+    Y + R+  S+T   GF ++     GIK   + G    DF     R  
Sbjct: 620 AEERRVQGVTKPRYMVWRETISSTATLGFRVE-----GIKL--AHGGSSKDFKTTRTREQ 672

Query: 442 FNVAHRRRKTGKVGFPHRLTKEV 510
              A RR      G+PH + K +
Sbjct: 673 VTEALRRFVE---GYPHAVPKYI 692


>DQ071552-1|AAY82248.1|  495|Apis mellifera anarchy 1 protein.
          Length = 495

 Score = 21.8 bits (44), Expect = 5.5
 Identities = 10/28 (35%), Positives = 17/28 (60%)
 Frame = +3

Query: 168 SLYFPRLGIQCGLLVSVVMKRLLSIVQS 251
           SL+   LGI+CG  +  +++  L I Q+
Sbjct: 462 SLFRINLGIECGYEIKKLLRYKLLISQN 489


>AY336529-1|AAQ02340.1|  712|Apis mellifera transferrin protein.
          Length = 712

 Score = 21.8 bits (44), Expect = 5.5
 Identities = 9/18 (50%), Positives = 12/18 (66%)
 Frame = +2

Query: 308 CGVTTSPPRVILASVFKN 361
           C +   PPRVIL+S  K+
Sbjct: 626 CNLGLEPPRVILSSGAKS 643


>AY336528-1|AAQ02339.1|  712|Apis mellifera transferrin protein.
          Length = 712

 Score = 21.8 bits (44), Expect = 5.5
 Identities = 9/18 (50%), Positives = 12/18 (66%)
 Frame = +2

Query: 308 CGVTTSPPRVILASVFKN 361
           C +   PPRVIL+S  K+
Sbjct: 626 CNLGLEPPRVILSSGAKS 643


>AY217097-1|AAO39761.1|  712|Apis mellifera transferrin protein.
          Length = 712

 Score = 21.8 bits (44), Expect = 5.5
 Identities = 9/18 (50%), Positives = 12/18 (66%)
 Frame = +2

Query: 308 CGVTTSPPRVILASVFKN 361
           C +   PPRVIL+S  K+
Sbjct: 626 CNLGLEPPRVILSSGAKS 643


>DQ257631-1|ABB82366.1|  424|Apis mellifera yellow e3-like protein
           protein.
          Length = 424

 Score = 21.4 bits (43), Expect = 7.3
 Identities = 8/18 (44%), Positives = 11/18 (61%)
 Frame = -1

Query: 266 SALALGLYNGQQSFHYDG 213
           S LA+G +N +  F Y G
Sbjct: 326 SDLAIGCWNSEHFFEYGG 343


>DQ244074-1|ABB36784.1|  517|Apis mellifera cytochrome P450
           monooxygenase protein.
          Length = 517

 Score = 21.0 bits (42), Expect = 9.6
 Identities = 10/21 (47%), Positives = 10/21 (47%)
 Frame = -1

Query: 494 RWGNPTFPVLRLLCATLKPGR 432
           RW  PT P   LL A    GR
Sbjct: 443 RWTTPTTPHSPLLVAPFGAGR 463


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 164,141
Number of Sequences: 438
Number of extensions: 3781
Number of successful extensions: 13
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 13
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 13
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 18337950
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -