BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20154 (580 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g53390.1 68416.m05892 transducin family protein / WD-40 repea... 33 0.14 At2g37160.1 68415.m04559 transducin family protein / WD-40 repea... 33 0.18 At5g05970.1 68418.m00661 transducin family protein / WD-40 repea... 31 0.73 At4g25900.1 68417.m03724 aldose 1-epimerase family protein simil... 29 2.2 At2g32620.1 68415.m03982 cellulose synthase family protein simil... 29 3.0 At3g44530.1 68416.m04786 transducin family protein / WD-40 repea... 28 3.9 At3g18060.1 68416.m02297 transducin family protein / WD-40 repea... 28 3.9 At4g07410.1 68417.m01136 transducin family protein / WD-40 repea... 27 6.8 At3g61480.1 68416.m06885 expressed protein 27 6.8 At2g20780.1 68415.m02442 mannitol transporter, putative similar ... 27 6.8 At2g01330.1 68415.m00050 transducin family protein / WD-40 repea... 27 6.8 At5g56400.1 68418.m07040 F-box family protein contains F-box dom... 27 9.0 At2g32610.1 68415.m03981 cellulose synthase family protein simil... 27 9.0 >At3g53390.1 68416.m05892 transducin family protein / WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); similar to Dystrophia myotonica-containing WD repeat motif protein DMR-N9 protein (DMWD) (DM9) (SP:Q08274) [Mus musculus]; simlar to DMR protein GI:18028289 [Homo sapiens]; Length = 558 Score = 33.1 bits (72), Expect = 0.14 Identities = 18/51 (35%), Positives = 27/51 (52%), Gaps = 3/51 (5%) Frame = +1 Query: 199 LFNVGTEKVL---RMLRGSATCISWSDDSKYILQVNSKGLVEILSAADHDV 342 +F+ T+K++ + G+ C SWS D KYIL LV++ S D V Sbjct: 329 IFDFLTQKLVCGGKSYYGALLCCSWSMDGKYILTGGEDDLVQVWSMEDRKV 379 >At2g37160.1 68415.m04559 transducin family protein / WD-40 repeat family protein contains 4 WD-40 repeats (PF00400); similar to Dystrophia myotonica-containing WD repeat motif protein DMR-N9 protein (DMWD) (DM9) (SP:Q08274) [Mus musculus]; simlar to DMR protein GI:18028289 [Homo sapiens]; Length = 544 Score = 32.7 bits (71), Expect = 0.18 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 3/51 (5%) Frame = +1 Query: 199 LFNVGTEKVL---RMLRGSATCISWSDDSKYILQVNSKGLVEILSAADHDV 342 +F+ T+K++ + G+ C +WS D KY+L LV++ S D V Sbjct: 329 IFDFSTQKLVCGVKSYYGALLCCAWSMDGKYLLTGGEDDLVQVWSMEDRKV 379 >At5g05970.1 68418.m00661 transducin family protein / WD-40 repeat family protein contains similarity to regulatory protein Nedd1; contains Pfam PF00400: WD domain, G-beta repeat (6 copies, 2 weak)|19804256|gb|AV785466.1|AV785466 Length = 781 Score = 30.7 bits (66), Expect = 0.73 Identities = 15/47 (31%), Positives = 26/47 (55%) Frame = +2 Query: 437 VMIWDTKNRMS*KRFQHLHTSLL*LRSYNAKNTSLAATMQNGDTVIY 577 V IWD + ++ K+ + HTS + YN K+ LA+ GD +++ Sbjct: 117 VKIWDLQRKLCIKKLKG-HTSTITGVMYNCKDEHLASVSVGGDLIVH 162 >At4g25900.1 68417.m03724 aldose 1-epimerase family protein similar to apospory-associated protein C; APOC [Chlamydomonas reinhardtii] GI:6970044 Pfam profile PF01263: Aldose 1-epimerase Length = 318 Score = 29.1 bits (62), Expect = 2.2 Identities = 21/79 (26%), Positives = 37/79 (46%), Gaps = 3/79 (3%) Frame = -3 Query: 458 SSCPISLHYRSWSTAMLRWPSRWKLAHQLSFNDKCCKLRTS*SAADNISTKPFEFTCNM- 282 S+ + L RS + + WP +++ +++ TS N TKPF FT + Sbjct: 129 STAHVDLIVRSSNEDLKIWPHKFEYRLRVALGHDGDLTLTS--RVKNTDTKPFNFTFALH 186 Query: 281 --YLLSSLHEIHVADPRNI 231 + +S++ EIHV N+ Sbjct: 187 PYFAVSNISEIHVEGLHNL 205 >At2g32620.1 68415.m03982 cellulose synthase family protein similar to Zea mays cellulose synthase-5 [gi:9622882], -4 [gi:9622880], -9 [gi:9622890] Length = 757 Score = 28.7 bits (61), Expect = 3.0 Identities = 11/41 (26%), Positives = 22/41 (53%), Gaps = 2/41 (4%) Frame = -3 Query: 524 HCSYEVTADWCEGVGNVF--MTFGSSCPISLHYRSWSTAML 408 HC YE W + +G ++ M+ + I +H R W+++ + Sbjct: 438 HCDYESQTSWGKTIGWLYDSMSEDMNTSIGIHSRGWTSSYI 478 >At3g44530.1 68416.m04786 transducin family protein / WD-40 repeat family protein contains 6 (4 significant) WD-40 repeats (PF0400); nuclear protein HIRA, mouse, PIR:S68141 Length = 1051 Score = 28.3 bits (60), Expect = 3.9 Identities = 14/44 (31%), Positives = 26/44 (59%), Gaps = 4/44 (9%) Frame = +1 Query: 199 LFNVGT-EKVLRMLR---GSATCISWSDDSKYILQVNSKGLVEI 318 L N+ T E++L LR GS C+ W+ +S+Y+ + +++I Sbjct: 42 LQNIDTKERLLATLRDHFGSVNCVRWAKNSRYVASGSDDQVIQI 85 >At3g18060.1 68416.m02297 transducin family protein / WD-40 repeat family protein similar to 66 kDa stress protein (SP:P90587) [Physarum polycephalum (Slime mold)]; similar to WDR1 protein GB:AAD05042 [Gallus gallus] (Genomics 56 (1), 59-69 (1999)); contains 11 WD-40 repeats (PF00400) Length = 609 Score = 28.3 bits (60), Expect = 3.9 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +1 Query: 238 RGSATCISWSDDSKYILQVNSKGLVEILSAADHDVRSL 351 +GS +SWS D K +L V++ +I +D+ SL Sbjct: 232 KGSIYAVSWSPDGKQVLTVSADKSAKIWDISDNGSGSL 269 >At4g07410.1 68417.m01136 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400) (2 weak); similar to Vegetatible incompatibility protein HET-E-1 (SP:Q00808) {Podospora anserina} Length = 815 Score = 27.5 bits (58), Expect = 6.8 Identities = 14/40 (35%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = +1 Query: 226 LRMLRGSATCISWSDDSKYILQVNSKGLVEILSAAD-HDV 342 L + G A ++WS D+K I +S GL+ A H+V Sbjct: 194 LPRVSGRALSVTWSPDAKRIFSGSSDGLIRCWDATSCHEV 233 >At3g61480.1 68416.m06885 expressed protein Length = 1091 Score = 27.5 bits (58), Expect = 6.8 Identities = 17/63 (26%), Positives = 31/63 (49%) Frame = +1 Query: 229 RMLRGSATCISWSDDSKYILQVNSKGLVEILSAADHDVRSLQHLSLKDSWCASFHRDGHR 408 + L G A C S + + + + KG+VE+ + H + L+ +SL D ++ + Sbjct: 206 KKLGGDAVCASVASEQQILAVGTRKGMVELYDLS-HSISLLRTVSLHDWGYSADYTGPVN 264 Query: 409 NIA 417 NIA Sbjct: 265 NIA 267 >At2g20780.1 68415.m02442 mannitol transporter, putative similar to mannitol transporter [Apium graveolens var. dulce] GI:12004316; contains Pfam profile PF00083: major facilitator superfamily protein Length = 526 Score = 27.5 bits (58), Expect = 6.8 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = -1 Query: 520 VATKLQQTGVKVLETFL*HSVLRVPYHYITVLGLRLC 410 VA + +T + TFL SV R P Y++ +G+ LC Sbjct: 343 VAVGVTKTVFILFATFLIDSVGRKPLLYVSTIGMTLC 379 >At2g01330.1 68415.m00050 transducin family protein / WD-40 repeat family protein contains 10 WD-40 repeats (PF00400); similar to 66kDa stress protein (SWISS-PROT: P90587)[ Physarum polycephalum (Slime mold)] Length = 474 Score = 27.5 bits (58), Expect = 6.8 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +1 Query: 238 RGSATCISWSDDSKYILQVNSKGLVEILSAAD 333 +GS +SWS DSK +L V++ ++ A+ Sbjct: 96 KGSIYAVSWSPDSKRVLTVSADKSAKVWEVAE 127 >At5g56400.1 68418.m07040 F-box family protein contains F-box domain Pfam:PF00646 Length = 455 Score = 27.1 bits (57), Expect = 9.0 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -3 Query: 407 RWPSRWKLAHQLSFNDK 357 RW S W H+L FND+ Sbjct: 65 RWESLWTKVHKLRFNDR 81 >At2g32610.1 68415.m03981 cellulose synthase family protein similar to Zea mays cellulose synthase-3 [gi:9622878], -2 [gi:9622876], -1 [gi:9622874] Length = 757 Score = 27.1 bits (57), Expect = 9.0 Identities = 10/41 (24%), Positives = 20/41 (48%), Gaps = 2/41 (4%) Frame = -3 Query: 524 HCSYEVTADWCEGVGNVFMTFGS--SCPISLHYRSWSTAML 408 HC YE W +G ++ + + I +H R W+++ + Sbjct: 439 HCQYEYQTSWGNTIGWLYDSVAEDLNTSIGIHSRGWTSSYI 479 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,882,708 Number of Sequences: 28952 Number of extensions: 231630 Number of successful extensions: 631 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 622 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 631 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1131744440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -