SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20083
         (676 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g65930.1 68414.m07481 isocitrate dehydrogenase, putative / NA...   136   2e-32
At1g54340.1 68414.m06195 isocitrate dehydrogenase, putative / NA...   135   3e-32
At5g14590.1 68418.m01711 isocitrate dehydrogenase, putative / NA...   132   2e-31
At3g51310.1 68416.m05616 vacuolar protein sorting-associated pro...    28   6.6  
At5g49680.1 68418.m06151 cell expansion protein, putative simila...    27   8.7  
At2g23450.2 68415.m02800 protein kinase family protein contains ...    27   8.7  
At2g23450.1 68415.m02799 protein kinase family protein contains ...    27   8.7  

>At1g65930.1 68414.m07481 isocitrate dehydrogenase, putative / NADP+
           isocitrate dehydrogenase, putative strong similarity to
           isocitrate dehydrogenase SP|Q40345 from [Medicago
           sativa]
          Length = 410

 Score =  136 bits (328), Expect = 2e-32
 Identities = 60/84 (71%), Positives = 71/84 (84%)
 Frame = +1

Query: 256 DGDEMTRIMWAKIKERLIFPYVKVDCLYFDLGLPHRDATDDQVTIDSAHAILKHNVGIKC 435
           DGDEMTR++W  IK++LI P+V++D  YFDLGLPHRDATDD+VTI+SA A  K+NV IKC
Sbjct: 16  DGDEMTRVIWKSIKDKLITPFVELDIKYFDLGLPHRDATDDKVTIESAEATKKYNVAIKC 75

Query: 436 ATITPDEQRVEEFKLKKMWLSPNG 507
           ATITPDE RV EF LK+MW SPNG
Sbjct: 76  ATITPDEGRVTEFGLKQMWRSPNG 99



 Score = 94.7 bits (225), Expect = 5e-20
 Identities = 39/58 (67%), Positives = 48/58 (82%)
 Frame = +3

Query: 498 PERKIRNILGGTVFREPILCQSIPRVVPGWTKPIVIGRHAHGDQYKAQDFVVPKPGKV 671
           P   IRNIL GTVFREPI+C+++P++VPGWTKPI IGRHA GDQY+A D V+  PGK+
Sbjct: 97  PNGTIRNILNGTVFREPIICKNVPKLVPGWTKPICIGRHAFGDQYRATDAVIKGPGKL 154


>At1g54340.1 68414.m06195 isocitrate dehydrogenase, putative / NADP+
           isocitrate dehydrogenase, putative strong similarity to
           NADP-isocitrate dehydrogenase GI:5764653 from [Citrus
           limon]; Nicotiana tabacum SP|P50218
          Length = 416

 Score =  135 bits (326), Expect = 3e-32
 Identities = 59/84 (70%), Positives = 72/84 (85%)
 Frame = +1

Query: 256 DGDEMTRIMWAKIKERLIFPYVKVDCLYFDLGLPHRDATDDQVTIDSAHAILKHNVGIKC 435
           DGDEMTR++W  IK++LIFP++++D  YFDLGLP+RD TDD+VTI++A A LK+NV IKC
Sbjct: 16  DGDEMTRVIWKFIKDKLIFPFLELDIKYFDLGLPNRDFTDDKVTIETAEATLKYNVAIKC 75

Query: 436 ATITPDEQRVEEFKLKKMWLSPNG 507
           ATITPDE RV EF LKKMW SPNG
Sbjct: 76  ATITPDEARVREFGLKKMWRSPNG 99



 Score = 98.3 bits (234), Expect = 4e-21
 Identities = 41/59 (69%), Positives = 50/59 (84%)
 Frame = +3

Query: 498 PERKIRNILGGTVFREPILCQSIPRVVPGWTKPIVIGRHAHGDQYKAQDFVVPKPGKVE 674
           P   IRNIL GTVFREPI+C++IPR+VPGWTKPI IGRHA GDQY+A D +V +PGK++
Sbjct: 97  PNGTIRNILNGTVFREPIICRNIPRLVPGWTKPICIGRHAFGDQYRATDLIVNEPGKLK 155


>At5g14590.1 68418.m01711 isocitrate dehydrogenase, putative / NADP+
           isocitrate dehydrogenase, putative strong similarity to
           isocitrate dehydrogenase (NADP+) [Nicotiana tabacum]
           GI:3021512; contains Pfam domain PF00180: dehydrogenase,
           isocitrate/isopropylmalate family
          Length = 485

 Score =  132 bits (320), Expect = 2e-31
 Identities = 58/84 (69%), Positives = 71/84 (84%)
 Frame = +1

Query: 256 DGDEMTRIMWAKIKERLIFPYVKVDCLYFDLGLPHRDATDDQVTIDSAHAILKHNVGIKC 435
           DGDEMTR++W+ IKE+LI PY+ +D  YFDLG+ +RDATDD+VT++SA A LK+NV IKC
Sbjct: 86  DGDEMTRVIWSMIKEKLILPYLDLDIKYFDLGILNRDATDDKVTVESAEAALKYNVAIKC 145

Query: 436 ATITPDEQRVEEFKLKKMWLSPNG 507
           ATITPDE RV+EF LK MW SPNG
Sbjct: 146 ATITPDEGRVKEFGLKSMWRSPNG 169



 Score = 93.5 bits (222), Expect = 1e-19
 Identities = 40/59 (67%), Positives = 47/59 (79%)
 Frame = +3

Query: 498 PERKIRNILGGTVFREPILCQSIPRVVPGWTKPIVIGRHAHGDQYKAQDFVVPKPGKVE 674
           P   IRNIL GTVFREPI+C +IPR+VPGW KPI IGRHA GDQY+A D V+  PGK++
Sbjct: 167 PNGTIRNILDGTVFREPIMCSNIPRLVPGWEKPICIGRHAFGDQYRATDTVIKGPGKLK 225


>At3g51310.1 68416.m05616 vacuolar protein sorting-associated
           protein 35 family protein / VPS35 family protein similar
           to vacuolar protein sorting 35 [Mus musculus]
           GI:11875394; contains Pfam profile PF03635: Vacuolar
           protein sorting-associated protein 35
          Length = 783

 Score = 27.9 bits (59), Expect = 6.6
 Identities = 19/43 (44%), Positives = 25/43 (58%), Gaps = 1/43 (2%)
 Frame = -2

Query: 582 QAQPSGYSDTISVRGILYRPKCYG-SSVRA*PHFLQLELFYSL 457
           Q QPS    T+ + G++ R   Y  SSV A P+FLQ+E F  L
Sbjct: 281 QLQPSVDIKTV-LSGLMERLSNYAASSVEALPNFLQVEAFSKL 322


>At5g49680.1 68418.m06151 cell expansion protein, putative similar to
            SABRE [Arabidopsis thaliana] GI:719291
          Length = 1378

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 13/61 (21%), Positives = 33/61 (54%), Gaps = 1/61 (1%)
 Frame = +1

Query: 265  EMTRIMWAKIKERLIFPYVKVDCLYFDLGLPHRDATDDQVTIDSAHAILKHNV-GIKCAT 441
            ++ +++W+ + +   F  V++D + +D    +RD    Q T  + + +L++ +   KC T
Sbjct: 904  QINKVIWSMVLDGKTFAEVEIDNMIYDFNRDYRDIGIAQFT--TRYVVLRNCLPNAKCDT 961

Query: 442  I 444
            +
Sbjct: 962  V 962


>At2g23450.2 68415.m02800 protein kinase family protein contains
           protein kinase domain, Pfam:PF00069
          Length = 708

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 16/58 (27%), Positives = 28/58 (48%)
 Frame = -3

Query: 671 NLSGFRYNKILRLVLVAVRMTAYHNRFRPTRHNPRDTLTQYRFAEYCTAQNVTDLPFG 498
           +L  +  + I  +  +A R  A+H+  RPT     D L Q R + +  + ++ D P G
Sbjct: 583 DLDAWTLSSIHTVAELAFRCLAFHSDMRPTMTEVADELEQIRLSGWIPSMSL-DSPAG 639


>At2g23450.1 68415.m02799 protein kinase family protein contains
           protein kinase domain, Pfam:PF00069
          Length = 708

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 16/58 (27%), Positives = 28/58 (48%)
 Frame = -3

Query: 671 NLSGFRYNKILRLVLVAVRMTAYHNRFRPTRHNPRDTLTQYRFAEYCTAQNVTDLPFG 498
           +L  +  + I  +  +A R  A+H+  RPT     D L Q R + +  + ++ D P G
Sbjct: 583 DLDAWTLSSIHTVAELAFRCLAFHSDMRPTMTEVADELEQIRLSGWIPSMSL-DSPAG 639


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,490,025
Number of Sequences: 28952
Number of extensions: 293014
Number of successful extensions: 638
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 623
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 638
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1432596384
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -