SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20079
         (698 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g54760.1 68418.m06820 eukaryotic translation initiation facto...    60   2e-09
At4g27130.1 68417.m03899 eukaryotic translation initiation facto...    60   2e-09
At1g54290.1 68414.m06189 eukaryotic translation initiation facto...    60   2e-09
At5g54940.2 68418.m06843 eukaryotic translation initiation facto...    56   2e-08
At5g54940.1 68418.m06842 eukaryotic translation initiation facto...    56   2e-08
At1g05530.1 68414.m00567 UDP-glucoronosyl/UDP-glucosyl transfera...    31   0.97 
At4g11175.1 68417.m01810 translation initiation factor IF-1, chl...    28   5.2  
At3g44920.1 68416.m04839 cation/hydrogen exchanger, putative (CH...    28   5.2  
At5g21930.1 68418.m02545 ATPase E1-E2 type family protein / halo...    27   9.0  
At1g75990.1 68414.m08824 26S proteasome regulatory subunit S3, p...    27   9.0  
At1g27900.1 68414.m03419 RNA helicase, putative similar to SP|Q1...    27   9.0  
At1g25210.1 68414.m03129 UDP-3-O-acyl N-acetylglycosamine deacet...    27   9.0  
At1g25141.1 68414.m03121 UDP-3-0-acyl N-acetylglucosamine deacet...    27   9.0  
At1g25054.1 68414.m03117 UDP-3-O-acyl N-acetylglycosamine deacet...    27   9.0  
At1g24880.1 68414.m03111 UDP-3-0-acyl N-acetylglucosamine deacet...    27   9.0  
At1g24793.1 68414.m03107 UDP-3-0-acyl N-acetylglucosamine deacet...    27   9.0  

>At5g54760.1 68418.m06820 eukaryotic translation initiation factor
           SUI1, putative similar to SP|P32911 Protein translation
           factor SUI1 {Saccharomyces cerevisiae}; contains Pfam
           profile PF01253: Translation initiation factor SUI1
          Length = 113

 Score = 59.7 bits (138), Expect = 2e-09
 Identities = 24/43 (55%), Positives = 35/43 (81%)
 Frame = +3

Query: 339 GTVVEHPEYGEVLQLQGDQRENICQWLTKSGLVKPEQLKVHGF 467
           GTVV+  E G+V+QLQGDQR+N+  +L ++GLVK + +K+HGF
Sbjct: 71  GTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF 113



 Score = 37.5 bits (83), Expect = 0.008
 Identities = 16/27 (59%), Positives = 19/27 (70%)
 Frame = +1

Query: 256 TLTTVQGLSSEYDLKKIVRACKKEFAC 336
           +LTTVQGL  EY   KI++  KKEF C
Sbjct: 43  SLTTVQGLKKEYSYTKILKDLKKEFCC 69



 Score = 36.3 bits (80), Expect = 0.020
 Identities = 16/31 (51%), Positives = 19/31 (61%)
 Frame = +2

Query: 164 FDPFADAIKSSEDDVQDGLVHVRIQQRNGRR 256
           FDPFADA            VH+R+QQRNGR+
Sbjct: 12  FDPFADANVEDSGAGTKEYVHIRVQQRNGRK 42


>At4g27130.1 68417.m03899 eukaryotic translation initiation factor
           SUI1, putative similar to SP|P32911 Protein translation
           factor SUI1 {Saccharomyces cerevisiae}; contains Pfam
           profile PF01253: Translation initiation factor SUI1
          Length = 113

 Score = 59.7 bits (138), Expect = 2e-09
 Identities = 24/43 (55%), Positives = 35/43 (81%)
 Frame = +3

Query: 339 GTVVEHPEYGEVLQLQGDQRENICQWLTKSGLVKPEQLKVHGF 467
           GTVV+  E G+V+QLQGDQR+N+  +L ++GLVK + +K+HGF
Sbjct: 71  GTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF 113



 Score = 37.5 bits (83), Expect = 0.008
 Identities = 16/27 (59%), Positives = 19/27 (70%)
 Frame = +1

Query: 256 TLTTVQGLSSEYDLKKIVRACKKEFAC 336
           +LTTVQGL  EY   KI++  KKEF C
Sbjct: 43  SLTTVQGLKKEYSYTKILKDLKKEFCC 69



 Score = 36.7 bits (81), Expect = 0.015
 Identities = 16/31 (51%), Positives = 19/31 (61%)
 Frame = +2

Query: 164 FDPFADAIKSSEDDVQDGLVHVRIQQRNGRR 256
           FDPFADA            VH+R+QQRNGR+
Sbjct: 12  FDPFADANAEDSGAGTKEYVHIRVQQRNGRK 42


>At1g54290.1 68414.m06189 eukaryotic translation initiation factor
           SUI1, putative similar to P|P32911 Protein translation
           factor SUI1 {Saccharomyces cerevisiae}; contains Pfam
           profile PF01253: Translation initiation factor SUI1
          Length = 113

 Score = 59.7 bits (138), Expect = 2e-09
 Identities = 24/43 (55%), Positives = 35/43 (81%)
 Frame = +3

Query: 339 GTVVEHPEYGEVLQLQGDQRENICQWLTKSGLVKPEQLKVHGF 467
           GTVV+  E G+V+QLQGDQR+N+  +L ++GLVK + +K+HGF
Sbjct: 71  GTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF 113



 Score = 38.3 bits (85), Expect = 0.005
 Identities = 17/39 (43%), Positives = 22/39 (56%)
 Frame = +2

Query: 140 MSIQNLNTFDPFADAIKSSEDDVQDGLVHVRIQQRNGRR 256
           + +Q    FDPFADA            VH+R+QQRNGR+
Sbjct: 4   LEVQVPTAFDPFADANAEDSGAGTKEYVHIRVQQRNGRK 42



 Score = 37.9 bits (84), Expect = 0.006
 Identities = 16/27 (59%), Positives = 19/27 (70%)
 Frame = +1

Query: 256 TLTTVQGLSSEYDLKKIVRACKKEFAC 336
           +LTTVQGL  EY   KI++  KKEF C
Sbjct: 43  SLTTVQGLKKEYSYSKILKDLKKEFCC 69


>At5g54940.2 68418.m06843 eukaryotic translation initiation factor
           SUI1, putative similar to SP|P32911 Protein translation
           factor SUI1 {Saccharomyces cerevisiae}; contains Pfam
           profile PF01253: Translation initiation factor SUI1
          Length = 112

 Score = 56.4 bits (130), Expect = 2e-08
 Identities = 21/43 (48%), Positives = 34/43 (79%)
 Frame = +3

Query: 339 GTVVEHPEYGEVLQLQGDQRENICQWLTKSGLVKPEQLKVHGF 467
           G VV+  E G+++QLQGDQR+ + Q+L ++G+ K +Q+K+HGF
Sbjct: 70  GNVVQDKELGKIIQLQGDQRKKVSQFLVQTGIAKKDQIKIHGF 112



 Score = 36.7 bits (81), Expect = 0.015
 Identities = 16/39 (41%), Positives = 26/39 (66%)
 Frame = +2

Query: 140 MSIQNLNTFDPFADAIKSSEDDVQDGLVHVRIQQRNGRR 256
           + IQ  + +DPFA+A  S     ++  +H+RIQQRNG++
Sbjct: 4   LDIQIPSAYDPFAEAKDSDAPGAKEN-IHIRIQQRNGKK 41



 Score = 35.9 bits (79), Expect = 0.026
 Identities = 14/27 (51%), Positives = 20/27 (74%)
 Frame = +1

Query: 256 TLTTVQGLSSEYDLKKIVRACKKEFAC 336
           +LTTVQGL  EY  ++I++  KK+F C
Sbjct: 42  SLTTVQGLKKEYSYERILKDLKKDFCC 68


>At5g54940.1 68418.m06842 eukaryotic translation initiation factor
           SUI1, putative similar to SP|P32911 Protein translation
           factor SUI1 {Saccharomyces cerevisiae}; contains Pfam
           profile PF01253: Translation initiation factor SUI1
          Length = 112

 Score = 56.4 bits (130), Expect = 2e-08
 Identities = 21/43 (48%), Positives = 34/43 (79%)
 Frame = +3

Query: 339 GTVVEHPEYGEVLQLQGDQRENICQWLTKSGLVKPEQLKVHGF 467
           G VV+  E G+++QLQGDQR+ + Q+L ++G+ K +Q+K+HGF
Sbjct: 70  GNVVQDKELGKIIQLQGDQRKKVSQFLVQTGIAKKDQIKIHGF 112



 Score = 36.7 bits (81), Expect = 0.015
 Identities = 16/39 (41%), Positives = 26/39 (66%)
 Frame = +2

Query: 140 MSIQNLNTFDPFADAIKSSEDDVQDGLVHVRIQQRNGRR 256
           + IQ  + +DPFA+A  S     ++  +H+RIQQRNG++
Sbjct: 4   LDIQIPSAYDPFAEAKDSDAPGAKEN-IHIRIQQRNGKK 41



 Score = 35.9 bits (79), Expect = 0.026
 Identities = 14/27 (51%), Positives = 20/27 (74%)
 Frame = +1

Query: 256 TLTTVQGLSSEYDLKKIVRACKKEFAC 336
           +LTTVQGL  EY  ++I++  KK+F C
Sbjct: 42  SLTTVQGLKKEYSYERILKDLKKDFCC 68


>At1g05530.1 68414.m00567 UDP-glucoronosyl/UDP-glucosyl transferase
           family protein contains Pfam profile: PF00201
           UDP-glucoronosyl and UDP-glucosyl transferase
          Length = 455

 Score = 30.7 bits (66), Expect = 0.97
 Identities = 21/52 (40%), Positives = 31/52 (59%), Gaps = 3/52 (5%)
 Frame = +2

Query: 104 VSLKQRDPTFNRMSIQNLN--TF-DPFADAIKSSEDDVQDGLVHVRIQQRNG 250
           +S+  R    N  +++NL+  TF D F D + S+ DDVQ+ LVH    +RNG
Sbjct: 41  LSVIHRSMIPNHNNVENLSFLTFSDGFDDGVISNTDDVQNRLVHF---ERNG 89


>At4g11175.1 68417.m01810 translation initiation factor IF-1,
           chloroplast, putative similar to Swiss-Prot:P08698
           translation initiation factor IF-1, chloroplast
           [Spinacia oleracea]; contains Pfam profile PF00575: S1
           RNA binding domain
          Length = 141

 Score = 28.3 bits (60), Expect = 5.2
 Identities = 15/43 (34%), Positives = 21/43 (48%)
 Frame = +1

Query: 160 HIRPIRRCYQKLGGRRSRWFSPRPYPATKRA*TLTTVQGLSSE 288
           +IRP+ RC +  GGR     S    P  K     T ++GL +E
Sbjct: 39  NIRPMIRCQRASGGRGGANRSKPAKPQVKEGSNKTVIEGLVTE 81


>At3g44920.1 68416.m04839 cation/hydrogen exchanger, putative
           (CHX11) monovalent cation:proton antiporter family 2
           (CPA2) member, PMID:11500563
          Length = 671

 Score = 28.3 bits (60), Expect = 5.2
 Identities = 18/50 (36%), Positives = 28/50 (56%), Gaps = 4/50 (8%)
 Frame = -1

Query: 416 PLA-NILSLVALKLQHLAVLRVLHDRTL---HANSFLHARTIFFRSYSEE 279
           P+A  +L LV L  Q   ++ V HD+ L   H NS++H   + FR + +E
Sbjct: 383 PIAVTVLHLVKLVGQINPII-VSHDKKLKRLHKNSYIHTANLAFRQFMQE 431


>At5g21930.1 68418.m02545 ATPase E1-E2 type family protein /
           haloacid dehalogenase-like hydrolase family protein /
           heavy-metal-associated domain-containing protein
           contains InterPro accession IPR001757: ATPase, E1-E2
           type; contains Pfam profiles PF00403:
           Heavy-metal-associated domain, PF00702: haloacid
           dehalogenase-like hydrolase
          Length = 883

 Score = 27.5 bits (58), Expect = 9.0
 Identities = 16/57 (28%), Positives = 27/57 (47%), Gaps = 4/57 (7%)
 Frame = +1

Query: 148 PESQHIRP----IRRCYQKLGGRRSRWFSPRPYPATKRA*TLTTVQGLSSEYDLKKI 306
           P S HIRP    + RC+ +L   R R    RP+     +  ++T    S+E  ++ +
Sbjct: 13  PSSLHIRPSKFLVNRCFPRLRRSRIRRHCSRPFFLVSNSVEISTQSFESTESSIESV 69


>At1g75990.1 68414.m08824 26S proteasome regulatory subunit S3,
           putative (RPN3) similar to 26S proteasome regulatory
           subunit S3 SP:P93768 [Nicotiana tabacum (Common
           tobacco)]
          Length = 487

 Score = 27.5 bits (58), Expect = 9.0
 Identities = 19/75 (25%), Positives = 38/75 (50%), Gaps = 6/75 (8%)
 Frame = +2

Query: 44  RAHNSALSVTVILLSA*YRSVSLKQRDPTFNRMSIQN------LNTFDPFADAIKSSEDD 205
           R HN  + +   ++    R++S+     +++R+S+Q+      LN+ +P ADA       
Sbjct: 342 RTHNLIVRLRHNVIRTGLRNISI-----SYSRISLQDVAQKLRLNSANPVADAESIVAKA 396

Query: 206 VQDGLVHVRIQQRNG 250
           ++DG +   I  +NG
Sbjct: 397 IRDGAIDATIDHKNG 411


>At1g27900.1 68414.m03419 RNA helicase, putative similar to
           SP|Q14562 ATP-dependent helicase DDX8 (RNA helicase
           HRH1) (DEAH-box protein 8) {Homo sapiens}; contains Pfam
           profiles PF04408: Helicase associated domain (HA2),
           PF00271: Helicase conserved C-terminal domain
          Length = 700

 Score = 27.5 bits (58), Expect = 9.0
 Identities = 16/60 (26%), Positives = 29/60 (48%)
 Frame = +1

Query: 67  SDSYIVECVVSQRFVETKRPYVQSYVHPESQHIRPIRRCYQKLGGRRSRWFSPRPYPATK 246
           +D  +   VV    + T RP++++    +   + PI+R  +KL  R+    S  P P+ K
Sbjct: 604 NDGMMPNYVVYHELISTTRPFMRNVCAVDMAWVAPIKRKIEKLNVRK---LSGGPAPSFK 660


>At1g25210.1 68414.m03129 UDP-3-O-acyl N-acetylglycosamine
           deacetylase family protein contains Pfam domain PF03331:
           UDP-3-O-acyl N-acetylglycosamine deacetylase
          Length = 955

 Score = 27.5 bits (58), Expect = 9.0
 Identities = 14/46 (30%), Positives = 22/46 (47%), Gaps = 1/46 (2%)
 Frame = -3

Query: 321 LACPHDL-LQVIFRGKALHRSQRLRPFRCWIRTWTKPS*TSSSELL 187
           L+C  D  L V++  + LH   R      W+ T  +P+  S S+ L
Sbjct: 798 LSCVRDQQLAVLYHNEGLHSDDRFTTVEFWVTTSIEPNSVSWSKFL 843


>At1g25141.1 68414.m03121 UDP-3-0-acyl N-acetylglucosamine
           deacetylase family protein / F-box protein-related
           contains weak hit to TIGRFAM TIGR01640 : F-box protein
           interaction domain and  weak hit to  Pfam PF00646: F-box
           domain;
          Length = 925

 Score = 27.5 bits (58), Expect = 9.0
 Identities = 14/46 (30%), Positives = 22/46 (47%), Gaps = 1/46 (2%)
 Frame = -3

Query: 321 LACPHDL-LQVIFRGKALHRSQRLRPFRCWIRTWTKPS*TSSSELL 187
           L+C  D  L V++  + LH   R      W+ T  +P+  S S+ L
Sbjct: 768 LSCVRDQQLAVLYHNEGLHSDDRFTTVEFWVTTSIEPNSVSWSKFL 813


>At1g25054.1 68414.m03117 UDP-3-O-acyl N-acetylglycosamine
           deacetylase family protein contains Pfam domain PF03331:
           UDP-3-O-acyl N-acetylglycosamine deacetylase
          Length = 949

 Score = 27.5 bits (58), Expect = 9.0
 Identities = 14/46 (30%), Positives = 22/46 (47%), Gaps = 1/46 (2%)
 Frame = -3

Query: 321 LACPHDL-LQVIFRGKALHRSQRLRPFRCWIRTWTKPS*TSSSELL 187
           L+C  D  L V++  + LH   R      W+ T  +P+  S S+ L
Sbjct: 792 LSCVRDQQLAVLYHNEGLHSDDRFTTVEFWVTTSIEPNSVSWSKFL 837


>At1g24880.1 68414.m03111 UDP-3-0-acyl N-acetylglucosamine
           deacetylase family protein / F-box protein-related
           contains weak hit to TIGRFAM TIGR01640 : F-box protein
           interaction domain and  weak hit to  Pfam PF00646: F-box
           domain; similar to ESTs dbj AV442495.1, gb|BE522756.1,
           gb|T42945.1, gb|BE525268.1, gb|BE523201.1,
           gb|BE526298.1, gb|T42945.1, gb|AA651584.1,
           dbj|AV552951.1, dbj|AV547151.1, dbj|AV563142.1
          Length = 905

 Score = 27.5 bits (58), Expect = 9.0
 Identities = 14/46 (30%), Positives = 22/46 (47%), Gaps = 1/46 (2%)
 Frame = -3

Query: 321 LACPHDL-LQVIFRGKALHRSQRLRPFRCWIRTWTKPS*TSSSELL 187
           L+C  D  L V++  + LH   R      W+ T  +P+  S S+ L
Sbjct: 748 LSCVRDQQLAVLYHNEGLHSDDRFTTVEFWVTTSIEPNSVSWSKFL 793


>At1g24793.1 68414.m03107 UDP-3-0-acyl N-acetylglucosamine
           deacetylase family protein / F-box protein-related
           contains weak hit to TIGRFAM TIGR01640 : F-box protein
           interaction domain and  weak hit to  Pfam PF00646: F-box
           domain; similar to ESTs dbj AV442495.1, gb|BE522756.1,
           gb|T42945.1, gb|BE525268.1, gb|BE523201.1,
           gb|BE526298.1, gb|T42945.1, gb|AA651584.1,
           dbj|AV552951.1, dbj|AV547151.1, dbj|AV563142.1
          Length = 925

 Score = 27.5 bits (58), Expect = 9.0
 Identities = 14/46 (30%), Positives = 22/46 (47%), Gaps = 1/46 (2%)
 Frame = -3

Query: 321 LACPHDL-LQVIFRGKALHRSQRLRPFRCWIRTWTKPS*TSSSELL 187
           L+C  D  L V++  + LH   R      W+ T  +P+  S S+ L
Sbjct: 768 LSCVRDQQLAVLYHNEGLHSDDRFTTVEFWVTTSIEPNSVSWSKFL 813


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,689,648
Number of Sequences: 28952
Number of extensions: 295473
Number of successful extensions: 832
Number of sequences better than 10.0: 16
Number of HSP's better than 10.0 without gapping: 806
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 832
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1496852856
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -