SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20078
         (633 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g19820.1 68418.m02355 PBS lyase HEAT-like repeat-containing p...    47   1e-05
At4g27640.1 68417.m03973 importin beta-2 subunit family protein ...    44   6e-05
At5g16000.1 68418.m01871 leucine-rich repeat family protein / pr...    28   4.5  
At2g43980.1 68415.m05469 inositol 1,3,4-trisphosphate 5/6-kinase...    28   5.9  
At5g56700.1 68418.m07077 F-box protein-related contains a partia...    27   7.8  
At5g47580.1 68418.m05873 expressed protein strong similarity to ...    27   7.8  

>At5g19820.1 68418.m02355 PBS lyase HEAT-like repeat-containing
           protein contains Pfam profile: PF03130 PBS lyase
           HEAT-like repeat
          Length = 1116

 Score = 46.8 bits (106), Expect = 1e-05
 Identities = 29/100 (29%), Positives = 48/100 (48%)
 Frame = +1

Query: 40  RQTAAVLLRRLFSAXXXXXXXXXXXXQQTVLREQLLLTLQMDLSQYLRRKVCDVVSELAR 219
           R  AAVLLR+L +              Q+ L+  +L  +Q + ++ + +K+CD VSELA 
Sbjct: 74  RAMAAVLLRKLLTRDDAYLWPRLSLSTQSSLKSSMLYCIQHEEAKSISKKICDTVSELAS 133

Query: 220 NHIDDDGNNQWPSSYSSCLPVPVRKIQTSKKLVLECLRLY 339
             + ++G  +       C+     K+Q S  L+L  L  Y
Sbjct: 134 GILPENGWPELLPFVFQCVTSVTPKLQESAFLILAQLSQY 173


>At4g27640.1 68417.m03973 importin beta-2 subunit family protein low
           similarity to importin 4 GI:18700635 from [Homo sapiens]
          Length = 1048

 Score = 44.4 bits (100), Expect = 6e-05
 Identities = 23/88 (26%), Positives = 47/88 (53%), Gaps = 1/88 (1%)
 Frame = +3

Query: 255 EFLQFMFTCASAQDPNIKEAGIRMFTSVPGVFGNRQTENLDVIKGMLISALQPNESMALR 434
           + L F+F C+ +   + +E  + +F+S+    GN        ++ +L+  +Q   S  +R
Sbjct: 118 DLLTFLFQCSQSAQEDHREVALILFSSLTETIGNTFRPYFADLQALLLKCMQDESSSRVR 177

Query: 435 TQAVKAVGAFI-LLHDKEPIIQKHFRMF 515
             A+KAVG+F+   +D + +++  FR F
Sbjct: 178 VAALKAVGSFLEFTNDGDEVVK--FRDF 203


>At5g16000.1 68418.m01871 leucine-rich repeat family protein /
           protein kinase family protein contains Pfam domains
           PF00560: Leucine Rich Repeat and PF00069: Protein kinase
           domain
          Length = 638

 Score = 28.3 bits (60), Expect = 4.5
 Identities = 7/26 (26%), Positives = 17/26 (65%)
 Frame = -2

Query: 377 IQVFSLTISKYTWYRRKHSNTSFFDV 300
           + +  + +  + W+R++H+  +FFDV
Sbjct: 258 VSLIFIAVGLFLWWRQRHNQNTFFDV 283


>At2g43980.1 68415.m05469 inositol 1,3,4-trisphosphate 5/6-kinase
           family protein contains Pfam profile PF05770: Inositol
           1, 3, 4-trisphosphate 5/6-kinase;  contains Prosite
           PS00591: Glycosyl hydrolases family 10 active site;
           similar to inositol 1,3,4-trisphosphate 5/6-kinase
           (GI:1322038) [Homo sapiens]
          Length = 488

 Score = 27.9 bits (59), Expect = 5.9
 Identities = 17/38 (44%), Positives = 24/38 (63%), Gaps = 1/38 (2%)
 Frame = -2

Query: 344 TWYRRKHSNTSF-FDVWILRTGTGKHEL*ELGHWLLPS 234
           TW R+K   T F FDV +++ GTG H + +L +  LPS
Sbjct: 425 TWLRKKLDLTIFGFDV-VIQEGTGDHVIVDLNY--LPS 459


>At5g56700.1 68418.m07077 F-box protein-related contains a partial
           F-box domain Pfam:PF00646
          Length = 360

 Score = 27.5 bits (58), Expect = 7.8
 Identities = 20/61 (32%), Positives = 30/61 (49%)
 Frame = +1

Query: 151 TLQMDLSQYLRRKVCDVVSELARNHIDDDGNNQWPSSYSSCLPVPVRKIQTSKKLVLECL 330
           TL MDL  ++R  V   V EL+ +  D       PSS  +C  +   K+   KK++L+  
Sbjct: 47  TLVMDLKSWVRIAVSRCVRELSISLHDTTAAVSLPSSLYTCKSLVTLKLY-GKKVLLDVP 105

Query: 331 R 333
           R
Sbjct: 106 R 106


>At5g47580.1 68418.m05873 expressed protein strong similarity to
           unknown protein (pir||E71441)
          Length = 748

 Score = 27.5 bits (58), Expect = 7.8
 Identities = 11/33 (33%), Positives = 19/33 (57%)
 Frame = -3

Query: 334 DVNILIPASLMFGSCALAQVNMNCRNSATGCCH 236
           DV I+I   ++FGS  +  ++++C      CCH
Sbjct: 357 DVCIVIQYVIVFGSKIIRYISVSCVGKILLCCH 389


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,858,875
Number of Sequences: 28952
Number of extensions: 286184
Number of successful extensions: 651
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 635
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 651
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1295224128
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -