SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20076
         (660 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g27130.1 68418.m03238 MADS-box family protein various predict...    33   0.13 
At4g09960.1 68417.m01629 MADS-box protein (AGL11)                      31   0.90 
At5g64430.1 68418.m08093 octicosapeptide/Phox/Bem1p (PB1) domain...    28   6.3  
At4g10560.1 68417.m01729 DC1 domain-containing protein contains ...    27   8.4  
At3g07530.1 68416.m00899 expressed protein ; expression supporte...    27   8.4  

>At5g27130.1 68418.m03238 MADS-box family protein various predicted
           MADS box proteins, Arabidopsis thaliana
          Length = 306

 Score = 33.5 bits (73), Expect = 0.13
 Identities = 16/52 (30%), Positives = 30/52 (57%), Gaps = 2/52 (3%)
 Frame = +2

Query: 257 VEMRVERLRKDTVRI--EEEKDSLLSTLDSIKHSELLLDISECDKDDITRYA 406
           +E R++R++K  +    +EEK  L+S+ D   +S   LD+ +CD    ++ A
Sbjct: 123 IEDRLQRMKKHVMACLEKEEKSQLVSSFDQNPNSTCSLDVEDCDGSSYSQIA 174


>At4g09960.1 68417.m01629 MADS-box protein (AGL11)
          Length = 230

 Score = 30.7 bits (66), Expect = 0.90
 Identities = 19/71 (26%), Positives = 33/71 (46%)
 Frame = +2

Query: 284 KDTVRIEEEKDSLLSTLDSIKHSELLLDISECDKDDITRYADRILSRAMTVEVTVRTDRD 463
           K+  ++E   +  +S + S KH  LL++I    K +I    + I  R    EV  R  + 
Sbjct: 122 KELKQVENRLEKAISRIRSKKHELLLVEIENAQKREIELDNENIYLRTKVAEVE-RYQQH 180

Query: 464 HQQEEALYQVN 496
           H Q  +  ++N
Sbjct: 181 HHQMVSGSEIN 191


>At5g64430.1 68418.m08093 octicosapeptide/Phox/Bem1p (PB1)
           domain-containing protein contains Pfam profile PF00564:
           PB1 domain
          Length = 513

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 13/30 (43%), Positives = 18/30 (60%)
 Frame = -1

Query: 237 VCLSAPAFLEPRIRR*GVVVNPLDTQSLMQ 148
           V L  P F +PR+ +   VVNP++ Q  MQ
Sbjct: 220 VALEPPLFNDPRVIQPDHVVNPMEIQRQMQ 249


>At4g10560.1 68417.m01729 DC1 domain-containing protein contains
           Pfam profile PF03107: DC1 domain
          Length = 703

 Score = 27.5 bits (58), Expect = 8.4
 Identities = 14/42 (33%), Positives = 20/42 (47%)
 Frame = -3

Query: 514 PAIDVHVHLIQSFLLLMVSVSAHCHLYGHSPGQDAVRVSCDI 389
           P  D  VHL    L  ++ +S H H    +P  D  R+SC +
Sbjct: 308 PPCDFVVHLRCIDLPRVIRISRHHHRISFTPSFDQERLSCGV 349


>At3g07530.1 68416.m00899 expressed protein ; expression supported
           by MPSS
          Length = 699

 Score = 27.5 bits (58), Expect = 8.4
 Identities = 12/27 (44%), Positives = 17/27 (62%)
 Frame = +2

Query: 299 IEEEKDSLLSTLDSIKHSELLLDISEC 379
           I + KDSLL+T DS++  E L  +  C
Sbjct: 310 ISDNKDSLLNTEDSLEEMEKLAFVCSC 336


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,314,366
Number of Sequences: 28952
Number of extensions: 303919
Number of successful extensions: 787
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 771
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 786
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1383534864
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -