SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20075
         (715 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g64000.1 68418.m08036 3'(2'),5'-bisphosphate nucleotidase, pu...    32   0.43 
At3g16860.1 68416.m02156 phytochelatin synthetase-related contai...    30   1.8  
At5g24440.1 68418.m02880 RNA-binding protein, putative                 29   2.3  
At4g15080.1 68417.m02317 zinc finger (DHHC type) family protein ...    28   7.1  
At2g37370.1 68415.m04583 hypothetical protein                          28   7.1  
At4g26040.1 68417.m03749 hypothetical protein                          27   9.3  
At3g06300.1 68416.m00723 oxidoreductase, 2OG-Fe(II) oxygenase fa...    27   9.3  
At2g46110.1 68415.m05735 ketopantoate hydroxymethyltransferase f...    27   9.3  

>At5g64000.1 68418.m08036 3'(2'),5'-bisphosphate nucleotidase,
           putative / inositol polyphosphate 1-phosphatase,
           putative similar to SP|Q42546 3'(2'),5'-bisphosphate
           nucleotidase (EC 3.1.3.7) {Arabidopsis thaliana};
           contains Pfam profile PF00459: Inositol monophosphatase
           family
          Length = 347

 Score = 31.9 bits (69), Expect = 0.43
 Identities = 24/81 (29%), Positives = 37/81 (45%), Gaps = 2/81 (2%)
 Frame = +2

Query: 233 AAEVVRQAGRRIFCPAVWNSNSPVNVTLMLYKEQMASQIVCQQSVQPQTLSLNAITEFCD 412
           AA + ++  + +    VW  +    VT   Y  Q    +V ++ +QP  LSL A  E  D
Sbjct: 17  AARLSQEVQKTLLQSQVWKKSDRSPVTAADYGSQAVVSLVLERELQPDKLSLVAEEETGD 76

Query: 413 LVPR--QQFGEDGDDLVQATI 469
           L     + F ED   LV+ T+
Sbjct: 77  LRKNGSEAFLEDIAKLVKDTL 97


>At3g16860.1 68416.m02156 phytochelatin synthetase-related contains
           Pfam PF04833: Phytochelatin synthetase-like conserved
           region
          Length = 653

 Score = 29.9 bits (64), Expect = 1.8
 Identities = 14/54 (25%), Positives = 19/54 (35%)
 Frame = -2

Query: 465 VACTKSSPSSPNCCLGTKSQNSVMAFRLSVCGCTDCWQTICEAICSLYSMRVTL 304
           V C  + P+ P CC+   S  +        C C  C        CS  S  + L
Sbjct: 400 VVCNITQPTPPKCCVSFSSYFNDSVIPCKTCACGGCSSDRVARTCSTTSPALPL 453


>At5g24440.1 68418.m02880 RNA-binding protein, putative
          Length = 320

 Score = 29.5 bits (63), Expect = 2.3
 Identities = 19/62 (30%), Positives = 30/62 (48%), Gaps = 2/62 (3%)
 Frame = +2

Query: 359 QSVQPQTLSLNAITEFC--DLVPRQQFGEDGDDLVQATIVVLAQAQVDTLQSMAKVFAPS 532
           Q++   T SL      C  D  P+ +     ++L+Q T  V  ++++  L  MAK F PS
Sbjct: 17  QNIDNNTTSLVETKPSCSDDQTPKSKSSVLTNELIQRTSEVNLKSEISHLNPMAKEFVPS 76

Query: 533 KL 538
            L
Sbjct: 77  FL 78


>At4g15080.1 68417.m02317 zinc finger (DHHC type) family protein
           contains Pfam profile PF01529: DHHC zinc finger domain
          Length = 718

 Score = 27.9 bits (59), Expect = 7.1
 Identities = 18/60 (30%), Positives = 26/60 (43%)
 Frame = -2

Query: 312 VTLTGLLEFHTAGQNILLPA*RTTSAAP*NHSNGDLCKLLNLVARAALSHSAEPVLRPAP 133
           VTL+ L + HTAG      A   +S  P N +   +             + A+P+L PAP
Sbjct: 513 VTLSPLPQHHTAGHRFTAAAASNSSRPPLNQATNHMIHSTFDEKIMQKGNHADPLLLPAP 572


>At2g37370.1 68415.m04583 hypothetical protein
          Length = 697

 Score = 27.9 bits (59), Expect = 7.1
 Identities = 19/64 (29%), Positives = 32/64 (50%)
 Frame = +3

Query: 18  DLTPKTTTNKLRVRKGRSVVHRNLEDNYGAVVIANHEALAQVLEQVQQSATMQPSLRGLK 197
           D+   T   KL   K + + H + ED   +   A+ EAL ++LEQV+  + ++  L   K
Sbjct: 230 DIEAHTLMEKLDKTKVKVLEHASSED--ASKTAASTEALREILEQVRTFSKLEALLLRKK 287

Query: 198 ACTN 209
           +  N
Sbjct: 288 SLHN 291


>At4g26040.1 68417.m03749 hypothetical protein 
          Length = 122

 Score = 27.5 bits (58), Expect = 9.3
 Identities = 21/80 (26%), Positives = 33/80 (41%), Gaps = 1/80 (1%)
 Frame = +1

Query: 421 QTTVWXXXXXFSTSNHRGFGPSTGGHLTKHGQSLRSVEALSTNSQLVPTEQVHEAIFMML 600
           QT V          +H+     T   +TK     R    L  +  LV  E +       +
Sbjct: 25  QTIVGEKITKMKEESHKTKQTKTEDPITKETYQARQRTLLQRDYLLVHIEDLLPKQVFAV 84

Query: 601 QLING-LKCLQARGVEEISE 657
            +IN  L C+QA+G+E +S+
Sbjct: 85  SVINDYLVCIQAQGLEPMSD 104


>At3g06300.1 68416.m00723 oxidoreductase, 2OG-Fe(II) oxygenase
           family protein similar to prolyl 4-hydroxylase, alpha
           subunit, from Rattus norvegicus [GI:474940], Mus
           musculus [SP|Q60715], Homo sapiens [GI:18073925];
           contains PF03171 2OG-Fe(II) oxygenase superfamily domain
          Length = 299

 Score = 27.5 bits (58), Expect = 9.3
 Identities = 12/27 (44%), Positives = 16/27 (59%)
 Frame = -3

Query: 710 SGTCIAWASLSATNEDKVSEISSTPRA 630
           S TC+  +  S  N  KV ++SS PRA
Sbjct: 21  SSTCLISSPSSIINPSKVKQVSSKPRA 47


>At2g46110.1 68415.m05735 ketopantoate hydroxymethyltransferase
           family protein similar to SP|Q9Y7B6
           3-methyl-2-oxobutanoate hydroxymethyltransferase (EC
           2.1.2.11) (Ketopantoate hydroxymethyltransferase)
           {Emericella nidulans}; contains Pfam profile PF02548:
           Ketopantoate hydroxymethyltransferase
          Length = 347

 Score = 27.5 bits (58), Expect = 9.3
 Identities = 16/58 (27%), Positives = 27/58 (46%)
 Frame = +2

Query: 269 FCPAVWNSNSPVNVTLMLYKEQMASQIVCQQSVQPQTLSLNAITEFCDLVPRQQFGED 442
           FC    N    +N  LM YKE+++ ++    S  P  ++ + +  F  L   Q+ G D
Sbjct: 275 FCKQYANVGEVINKALMEYKEEVSKKVFPGPSHSPYKITASELDGF--LTELQKLGFD 330


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,389,354
Number of Sequences: 28952
Number of extensions: 344829
Number of successful extensions: 1063
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 1032
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1063
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1545769616
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -