SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20074
         (622 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At2g48060.1 68415.m06015 hypothetical protein                          33   0.20 
At3g60630.1 68416.m06784 scarecrow transcription factor family p...    29   1.9  
At5g56420.2 68418.m07043 F-box family protein contains F-box dom...    28   5.7  
At5g56420.1 68418.m07042 F-box family protein contains F-box dom...    28   5.7  
At3g63380.1 68416.m07135 calcium-transporting ATPase, plasma mem...    28   5.7  

>At2g48060.1 68415.m06015 hypothetical protein
          Length = 621

 Score = 32.7 bits (71), Expect = 0.20
 Identities = 15/37 (40%), Positives = 23/37 (62%)
 Frame = -1

Query: 169 NIYYLFIYNLKFIYTNIIKRKDLFVCLFRIGSETTGP 59
           NI  L++Y L   ++++I+    F+ LFRI  ET GP
Sbjct: 281 NIVLLYLYQLPINFSDMIRWIASFIGLFRISLETEGP 317


>At3g60630.1 68416.m06784 scarecrow transcription factor family
           protein scarecrow-like 6, Arabidopsis thaliana,
           EMBL:AF036303
          Length = 623

 Score = 29.5 bits (63), Expect = 1.9
 Identities = 19/49 (38%), Positives = 27/49 (55%), Gaps = 1/49 (2%)
 Frame = +1

Query: 217 RMRTSAAHSLSLCSFYSPSTGALNV*LNLVGSRIRSFTSKMSV-FKILL 360
           R R+S+A SL + +F SPST +    L      +RSF  +  V F+I L
Sbjct: 385 RNRSSSAPSLKITAFASPSTVSDEFELRFTEENLRSFAGETGVSFEIEL 433


>At5g56420.2 68418.m07043 F-box family protein contains F-box domain
           Pfam:PF00646
          Length = 422

 Score = 27.9 bits (59), Expect = 5.7
 Identities = 16/51 (31%), Positives = 26/51 (50%)
 Frame = +2

Query: 362 VQLYIYMFVSLLCLSYASGRGLVHSTKVLQKCMTVASILIVDKTVCVDVTC 514
           V++ +  FV  L +SY SG   +   K L  C T+A +L ++     D +C
Sbjct: 100 VRIGVDRFVRELSVSYCSGEEPIRLPKCLFTCSTLA-VLKLENITLEDASC 149


>At5g56420.1 68418.m07042 F-box family protein contains F-box domain
           Pfam:PF00646
          Length = 422

 Score = 27.9 bits (59), Expect = 5.7
 Identities = 16/51 (31%), Positives = 26/51 (50%)
 Frame = +2

Query: 362 VQLYIYMFVSLLCLSYASGRGLVHSTKVLQKCMTVASILIVDKTVCVDVTC 514
           V++ +  FV  L +SY SG   +   K L  C T+A +L ++     D +C
Sbjct: 100 VRIGVDRFVRELSVSYCSGEEPIRLPKCLFTCSTLA-VLKLENITLEDASC 149


>At3g63380.1 68416.m07135 calcium-transporting ATPase, plasma
           membrane-type, putative / Ca(2+)-ATPase, putative
           (ACA12) identical to SP|Q9LY77 Potential
           calcium-transporting ATPase 12, plasma membrane-type (EC
           3.6.3.8) (Ca(2+)-ATPase isoform 12) {Arabidopsis
           thaliana}; similar to SP|Q9LF79 Calcium-transporting
           ATPase 8, plasma membrane-type (EC 3.6.3.8)
           (Ca2+-ATPase, isoform 8) {Arabidopsis thaliana};
           contains InterPro Accession IPR006069: Cation
           transporting ATPase
          Length = 1033

 Score = 27.9 bits (59), Expect = 5.7
 Identities = 15/57 (26%), Positives = 29/57 (50%)
 Frame = +1

Query: 205 TVATRMRTSAAHSLSLCSFYSPSTGALNV*LNLVGSRIRSFTSKMSVFKILLSSIIH 375
           TV    + +A   L++CS Y  STG++++  +   SRI++    M+   +   +  H
Sbjct: 568 TVHVHWKGAAEMVLAMCSHYYTSTGSVDLMDSTAKSRIQAIIQGMAASSLRCIAFAH 624


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,555,259
Number of Sequences: 28952
Number of extensions: 207880
Number of successful extensions: 396
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 390
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 396
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1255974912
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -