SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20072
         (691 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g65620.1 68418.m08255 peptidase M3 family protein / thimet ol...    31   0.54 
At5g58330.1 68418.m07303 malate dehydrogenase [NADP], chloroplas...    29   3.8  
At5g02330.1 68418.m00156 DC1 domain-containing protein contains ...    28   5.1  
At5g55780.1 68418.m06952 DC1 domain-containing protein contains ...    28   6.7  
At3g11980.1 68416.m01482 male sterility protein 2 (MS2) identica...    28   6.7  
At2g13900.1 68415.m01542 DC1 domain-containing protein contains ...    28   6.7  
At5g16730.1 68418.m01959 expressed protein weak similarity to mi...    27   8.9  
At4g13650.1 68417.m02123 pentatricopeptide (PPR) repeat-containi...    27   8.9  
At2g27990.1 68415.m03392 homeodomain-containing protein                27   8.9  
At2g13950.1 68415.m01550 DC1 domain-containing protein contains ...    27   8.9  

>At5g65620.1 68418.m08255 peptidase M3 family protein / thimet
           oligopeptidase family protein similar to SP|P27237
           Oligopeptidase A (EC 3.4.24.70) {Salmonella
           typhimurium}; contains Pfam profile PF01432: Peptidase
           family M3
          Length = 791

 Score = 31.5 bits (68), Expect = 0.54
 Identities = 22/63 (34%), Positives = 32/63 (50%)
 Frame = -3

Query: 653 VSTPQGLGSWRISQLSQAPKIDRIYSHSCTSRSSRWRNSIPFPIQFSSSLEFVVRQSRNA 474
           ++TP    S  ++ L ++PK     S SC  R S +R S P PI +SSS  F +   R+ 
Sbjct: 3   MATPTSRAS--LNLLRRSPKPKYFSSSSCHFRPSTFRKSYPCPI-WSSSFSFCLPPPRST 59

Query: 473 QLT 465
             T
Sbjct: 60  TST 62


>At5g58330.1 68418.m07303 malate dehydrogenase [NADP], chloroplast,
           putative strong similiarity to chloroplast
           NADP-dependent malate dehydrogenase (EC 1.1.1.82)
           SP|O48902 {Medicago sativa}, SP|P21528 {Pisum sativum},
           SP|Q05145 {Mesembryanthemum crystallinum}, SP|P46489
           {Flaveria bidentis}, [Flaveria trinervia] GI:726334,
           SP|P17606I {Sorghum bicolor}; contains InterPro entry
           IPR001236: Lactate/malate dehydrogenase
          Length = 443

 Score = 28.7 bits (61), Expect = 3.8
 Identities = 13/31 (41%), Positives = 17/31 (54%)
 Frame = -3

Query: 689 SHRPRCAIPPRHVSTPQGLGSWRISQLSQAP 597
           +H     +PP H +TP    S  +SQ SQAP
Sbjct: 32  NHFRHLLLPPLHTTTPNSKISCSVSQNSQAP 62


>At5g02330.1 68418.m00156 DC1 domain-containing protein contains
           Pfam profile PF03107: DC1 domain
          Length = 656

 Score = 28.3 bits (60), Expect = 5.1
 Identities = 9/36 (25%), Positives = 19/36 (52%)
 Frame = +1

Query: 442 CVECSRNTVSWALRLCLTTNSKLDENCIGNGIELRH 549
           C  C R+ +     +CLT +    + C+ + +E++H
Sbjct: 143 CGACERSKIGTDYYICLTCDLMFHKECVESPLEIKH 178


>At5g55780.1 68418.m06952 DC1 domain-containing protein contains
           Pfam profile PF03107: DC1 domain
          Length = 685

 Score = 27.9 bits (59), Expect = 6.7
 Identities = 10/36 (27%), Positives = 18/36 (50%)
 Frame = +1

Query: 442 CVECSRNTVSWALRLCLTTNSKLDENCIGNGIELRH 549
           C  C+ N  S +   CL    K  + C+ + +E++H
Sbjct: 136 CRACNGNIFSTSYFTCLQCQGKFHKECVESPLEIKH 171


>At3g11980.1 68416.m01482 male sterility protein 2 (MS2) identical
           to male sterility protein 2 (MS2) SP:Q08891 (Arabidopsis
           thaliana)
          Length = 616

 Score = 27.9 bits (59), Expect = 6.7
 Identities = 16/55 (29%), Positives = 23/55 (41%)
 Frame = +3

Query: 276 LRKNRASLAEWEYTSNITKENEEKSIQTHLELSRQEKAAWEETKMYGWQDFQDFT 440
           L  NR +L + +    +  E   K  Q   E  + +    E  + YGWQD   FT
Sbjct: 307 LEGNRKAL-DVDREMKLALEAARKGTQNQDEAQKMKDLGLERARSYGWQDTYVFT 360


>At2g13900.1 68415.m01542 DC1 domain-containing protein contains
           Pfam protein PF03107 DC1 domain
          Length = 661

 Score = 27.9 bits (59), Expect = 6.7
 Identities = 9/36 (25%), Positives = 19/36 (52%)
 Frame = +1

Query: 442 CVECSRNTVSWALRLCLTTNSKLDENCIGNGIELRH 549
           C  C R+ +     +CLT +    + C+ + +E++H
Sbjct: 145 CGACERSKIGTNYYVCLTCDLMFHKECVESPLEIKH 180


>At5g16730.1 68418.m01959 expressed protein weak similarity to
           microtubule binding protein D-CLIP-190 [Drosophila
           melanogaster] GI:2773363, SMC2-like condensin
           [Arabidopsis thaliana] GI:14279543
          Length = 853

 Score = 27.5 bits (58), Expect = 8.9
 Identities = 15/36 (41%), Positives = 24/36 (66%), Gaps = 1/36 (2%)
 Frame = +3

Query: 282 KNRASLAEWEYTSNITKENEEKS-IQTHLELSRQEK 386
           KNRA   E + TS + + +EEKS + + LE S++E+
Sbjct: 424 KNRALKKEQDATSRVQRLSEEKSKLLSDLESSKEEE 459


>At4g13650.1 68417.m02123 pentatricopeptide (PPR) repeat-containing
           protein contains Pfam profile PF01535: PPR repeat
          Length = 1064

 Score = 27.5 bits (58), Expect = 8.9
 Identities = 11/27 (40%), Positives = 15/27 (55%)
 Frame = +1

Query: 436 SRCVECSRNTVSWALRLCLTTNSKLDE 516
           +R +  +  T+ W L  CL TN  LDE
Sbjct: 77  NRGIRPNHQTLKWLLEGCLKTNGSLDE 103


>At2g27990.1 68415.m03392 homeodomain-containing protein 
          Length = 584

 Score = 27.5 bits (58), Expect = 8.9
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = -3

Query: 644 PQGLGSWRISQLSQAPKIDRIYSHS 570
           PQG  +WRIS LSQ   ++  Y  +
Sbjct: 79  PQGPSNWRISDLSQPSTVNHGYDQA 103


>At2g13950.1 68415.m01550 DC1 domain-containing protein contains
           Pfam profile PF03107: DC1 domain
          Length = 517

 Score = 27.5 bits (58), Expect = 8.9
 Identities = 9/36 (25%), Positives = 16/36 (44%)
 Frame = +1

Query: 442 CVECSRNTVSWALRLCLTTNSKLDENCIGNGIELRH 549
           C  C    +  A   C T   K  + C+ + +E++H
Sbjct: 33  CSACKLTNLGTAYYFCATCRKKFHKECVESPLEIKH 68


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,535,930
Number of Sequences: 28952
Number of extensions: 285532
Number of successful extensions: 878
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 845
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 878
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1467502800
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -