SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20070
         (639 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g49970.2 68418.m06187 pyridoxamine 5'-phosphate oxidase-relat...    93   1e-19
At5g49970.1 68418.m06188 pyridoxamine 5'-phosphate oxidase-relat...    93   1e-19
At3g26125.1 68416.m03258 cytochrome P450, putative                     29   2.6  
At1g50020.1 68414.m05613 expressed protein                             29   2.6  
At5g59590.1 68418.m07467 UDP-glucoronosyl/UDP-glucosyl transfera...    29   3.4  
At1g13150.1 68414.m01525 cytochrome P450, putative strong simila...    29   3.4  
At3g23890.1 68416.m03002 DNA topoisomerase, ATP-hydrolyzing / DN...    28   4.5  
At1g13140.1 68414.m01523 cytochrome P450 family protein similar ...    28   6.0  

>At5g49970.2 68418.m06187 pyridoxamine 5'-phosphate oxidase-related
           contains weak similarity to Pyridoxamine 5'-phosphate
           oxidase (EC 1.4.3.5) (PNP/PMP oxidase) (PNPOx).
           (Swiss-Prot:P28225) [Shigella flexneri]
          Length = 466

 Score = 93.1 bits (221), Expect = 1e-19
 Identities = 43/67 (64%), Positives = 52/67 (77%)
 Frame = +2

Query: 308 YLNQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGG 487
           YL Q EAA +D+ L     FS+DQLMELAGLSVA++IA+V+ P  +S  L +CGPGNNGG
Sbjct: 75  YLTQREAAEIDETLMGPLGFSIDQLMELAGLSVAASIAEVYKPEEYSRVLAICGPGNNGG 134

Query: 488 DGLVAAR 508
           DGLVAAR
Sbjct: 135 DGLVAAR 141



 Score = 36.3 bits (80), Expect = 0.017
 Identities = 18/40 (45%), Positives = 23/40 (57%), Gaps = 2/40 (5%)
 Frame = +1

Query: 520 FGYNVSVHYPKRTPKPLYENLLEQCIRFNVNI--IDKLPD 633
           FGY   + YPKRT KPLY  L+ Q    +V    ++ LPD
Sbjct: 146 FGYKPFICYPKRTAKPLYTGLVTQLDSLSVPFVSVEDLPD 185


>At5g49970.1 68418.m06188 pyridoxamine 5'-phosphate oxidase-related
           contains weak similarity to Pyridoxamine 5'-phosphate
           oxidase (EC 1.4.3.5) (PNP/PMP oxidase) (PNPOx).
           (Swiss-Prot:P28225) [Shigella flexneri]
          Length = 530

 Score = 93.1 bits (221), Expect = 1e-19
 Identities = 43/67 (64%), Positives = 52/67 (77%)
 Frame = +2

Query: 308 YLNQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGG 487
           YL Q EAA +D+ L     FS+DQLMELAGLSVA++IA+V+ P  +S  L +CGPGNNGG
Sbjct: 75  YLTQREAAEIDETLMGPLGFSIDQLMELAGLSVAASIAEVYKPEEYSRVLAICGPGNNGG 134

Query: 488 DGLVAAR 508
           DGLVAAR
Sbjct: 135 DGLVAAR 141



 Score = 36.3 bits (80), Expect = 0.017
 Identities = 18/40 (45%), Positives = 23/40 (57%), Gaps = 2/40 (5%)
 Frame = +1

Query: 520 FGYNVSVHYPKRTPKPLYENLLEQCIRFNVNI--IDKLPD 633
           FGY   + YPKRT KPLY  L+ Q    +V    ++ LPD
Sbjct: 146 FGYKPFICYPKRTAKPLYTGLVTQLDSLSVPFVSVEDLPD 185


>At3g26125.1 68416.m03258 cytochrome P450, putative
          Length = 541

 Score = 29.1 bits (62), Expect = 2.6
 Identities = 11/22 (50%), Positives = 16/22 (72%), Gaps = 1/22 (4%)
 Frame = +2

Query: 521 SDTMYRYIILNAHPNLCM-KTF 583
           SD  ++Y++ NA P LC+ KTF
Sbjct: 464 SDDQFKYVVFNAGPRLCLGKTF 485


>At1g50020.1 68414.m05613 expressed protein
          Length = 209

 Score = 29.1 bits (62), Expect = 2.6
 Identities = 13/41 (31%), Positives = 22/41 (53%)
 Frame = -1

Query: 555 AFRIMYRYIVSEQLHILAATKPSPPLFPGPHTIRADE*VEG 433
           AF  +Y Y  ++ +H  + T  SPP +  P+ +  DE + G
Sbjct: 163 AFSALYLYFGADFIHDGSRTPVSPPPYIDPYALLEDERISG 203


>At5g59590.1 68418.m07467 UDP-glucoronosyl/UDP-glucosyl transferase
           family protein contains Pfam profile: PF00201
           UDP-glucoronosyl and UDP-glucosyl transferase
          Length = 449

 Score = 28.7 bits (61), Expect = 3.4
 Identities = 9/25 (36%), Positives = 16/25 (64%)
 Frame = +3

Query: 30  RIIHNNTYHTIKCIIYDTYLYR*HA 104
           +++H    + I C++YD Y+Y  HA
Sbjct: 98  QLLHEQCNNDIACVVYDEYMYFSHA 122


>At1g13150.1 68414.m01525 cytochrome P450, putative strong
           similarity to gi|3313615 F21J9.9 from Arabidopsis
           thaliana and is a member of the PF|00067 Cytochrome P450
           family
          Length = 529

 Score = 28.7 bits (61), Expect = 3.4
 Identities = 11/22 (50%), Positives = 16/22 (72%), Gaps = 1/22 (4%)
 Frame = +2

Query: 521 SDTMYRYIILNAHPNLCM-KTF 583
           SD  ++Y++ NA P LC+ KTF
Sbjct: 449 SDDQFKYVVFNAGPRLCIGKTF 470


>At3g23890.1 68416.m03002 DNA topoisomerase, ATP-hydrolyzing / DNA
           topoisomerase II / DNA gyrase (TOP2) identical to
           SP|P30182 DNA topoisomerase II (EC 5.99.1.3)
           {Arabidopsis thaliana}
          Length = 1473

 Score = 28.3 bits (60), Expect = 4.5
 Identities = 19/67 (28%), Positives = 34/67 (50%), Gaps = 1/67 (1%)
 Frame = -3

Query: 313 EVPRHSVALIHTARHSSDVISFATRN-IRALPNNLYNNI*EDSFTVFLLLIIDT*FGSKC 137
           ++  H VA ++    +++V +   +N +    N L +N   DS T   L +  + FGSKC
Sbjct: 335 QITNHIVAAVNKKNKNANVKAHNVKNHLWVFVNALIDNPAFDSQTKETLTLRQSSFGSKC 394

Query: 136 QLK*YFI 116
           +L   F+
Sbjct: 395 ELSEDFL 401


>At1g13140.1 68414.m01523 cytochrome P450 family protein similar to
           Cytochrome P450 86A2 (SP:O23066) [Arabidopsis thaliana];
           contains Pfam PF|00067 Cytochrome P450 family
          Length = 519

 Score = 27.9 bits (59), Expect = 6.0
 Identities = 10/22 (45%), Positives = 16/22 (72%), Gaps = 1/22 (4%)
 Frame = +2

Query: 521 SDTMYRYIILNAHPNLCM-KTF 583
           +D  ++Y++ NA P LC+ KTF
Sbjct: 441 NDDQFKYVVFNAGPRLCLGKTF 462


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,143,382
Number of Sequences: 28952
Number of extensions: 264799
Number of successful extensions: 588
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 574
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 588
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1314848736
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -